Search by BoMiProt ID - Bomi4388


Primary Information

BoMiProt ID Bomi4388
Protein Name Cadherin-13
Organism Bos taurus
Uniprot IdQ3B7N0
Milk FractionWhey
Aminoacid Length 713
Molecular Weight 78197
Fasta Sequence https://www.uniprot.org/uniprot/Q3B7N0.fasta
Gene Name CDH13
Gene Id 512302
Protein Existence Status reviewed

Secondary Information

Protein Function calcium-dependent cell adhesion proteins.imp for cell to cell attachment and communication
Biochemical Properties It lacks both transmembrane and cytoplasmic domains and is linked to the plasma membrane via a glycosylphosphatidylinositol moiety.
PTMs Cleavage on pair of basic residues, Glycosylation, GPI-anchor, Lipoprotein
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3B7N0|CAD13_BOVIN Cadherin-13 OS=Bos taurus OX=9913 GN=CDH13 PE=2 SV=1 MQPATPLVLCVLLSQVLLLTSAEDLDCTPGFQQKVFHIDQPAEFIEDQAILN*52LTFSDCKG NDKLHYEVSSPYFRVNTDGSLVALRN*86ITAVGKTLFVHARTPHAEDMAELVIVGGKDIQGS LQDIFKFARTSPVPRQKRSIVVSPILIPENQRQPFPRDVGKVVDSDRPEGSKFRLTGKGV DQEPKGIFRINENTGSVSVTRNLDRETIATYQLFVETVDVNGRTLEGPVPLEVIVIDQND NRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFY IDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTGTATATIMIDDKNDHS PKFTKKEFQATVEEGAMGVIVN*382LTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTN EGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGSSSTATVHITVLDANESPVFYPD PMMVTKQEN*489ISVGSVLLTVN*500ATDPDSLQRQTIRYSVYKDPAGWLNINPIN*530GTVDTTALLD RESPFVHNSVYTALFLATDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKN*598LS VVILGATDKDLHPNTDPFKFEIHKQTVPDKVWKISKIN*638NTHALVSLLQNLNKANYHLPIM VTDSGKPPMTN*671ITDLRVQVCSCKNSKVDCNAAGAPHFSAATALLLSLFSLARL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments CDH13 has been associated with the risk for attention-deficit/hyperactivity disorder (ADHD) and frequent comorbid conditions including drug and alcohol abuse
Bibliography Rivero, O., Selten, M., Sich, S. et al. Cadherin-13, a risk gene for ADHD and comorbid disorders, impacts GABAergic function in hippocampus and cognition. Transl Psychiatry 5, e655 (2015). https://doi.org/10.1038/tp.2015.152