Search by BoMiProt ID - Bomi4343


Primary Information

BoMiProt ID Bomi4343
Protein Name BTB/POZ domain-containing protein KCTD19
Organism Bos taurus
Uniprot IdA7YWH3
Milk FractionWhey
Ref Sequence Id NP_001098862.1
Aminoacid Length 927
Molecular Weight 105078
Fasta Sequence https://www.uniprot.org/uniprot/A7YWH3.fasta
Gene Name KCTD19
Gene Id 523858
Protein Existence Status reviewed

Secondary Information

Protein Function KCTD19 associates with ZFP541 and HDAC1 and essential factor for meiosis.Important for male fertility
Biochemical Properties KCTD family proteins lack predicted transmembrane domains.Contain single N‐terminal BTB/POZ (bric‐a‐brac, tramtrak, and broad complex/poxvirus zinc finger) domain, the BTB domain of KCTD19 is required for protein function.The protein is 926 amino acids long.KCTDs are responsible for selecting protein substrates for ubiquitination by cullin‐RING ubiquitin ligases (CRLs) that bind to the BTB domains of KCTD proteins.KCTDs (clade F) interacts with the cytoplasmic tail of membrane‐embedded GABAB neurotransmitter receptors allowing the KCTD C‐terminus to transmit a signal that modulates channels in close proximity.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7YWH3|KCD19_BOVIN BTB/POZ domain-containing protein KCTD19 OS=Bos taurus OX=9913 GN=KCTD19 PE=2 SV=1 MEEPGMPHESAEDLFHFNVGGWHFSVPRSKLAQFPDSLLWKEASALTSSENQRLFIDRDG STFRHVHYYLYTSKLSFSSCAELNLLYEQALGLQLMPLLQTLDNLKEGKHHLRVRPADIP VAERASLNYWRTWKCISKPSEFPIKSPAFTGLHDKAPLGLMDTPLLDTEEEVHYCFLPLD LVAKHPSLVTEDNLLWLAETMALIECECSEFRFIVNFLRSQKILLPDNFSNIDVLEAEVE ILEIPELSEAVRLYRMNMGGCSRTSCPPPS*270PGKGGRSAGLESVKPLYMMALGLLVKYPDS ALGQLRIESTLDGSRLYITGNGVLFQHVKNWLGTCRLPLTETVSEVYELCAFLDKRDITY EPMKVALKTHLEPRTLAPMDVLNEEWTAEITVYSSQQIIKVYVGSHWYATTLQTLLKYPE LLSNPQRVYWITYGQTLLIYGDGQMFRHILNFLRLGKLFLPTEFKEWPLLCQEVEEYHIP SLSEALVQCEAYKSWIQEKESENEEAFPIRRLHVVTEGPGSLVEFSRDTKETMACVPMEF QDCNDRTMWNKAKGTLARSSQIEEAEQYSQTIQMSLCRGAKRAGNPSTYSHCPGLCANPR HWGGHPESPPKKKCTTVNLTQKPETKDPPVTPMQKLISLVREWDMVNCKQWEFQSLPAPR NSSLEEATLQHSSGSEAVSQPSTSASWKGHSTASEKDPGPQAGAGAGTKDKGPEPNFNPY FPMKRAVALKDWGKQRSKERENPAFELTLPEASEGDNTGVILKVTHPPVVGSDGSCMFFE DSIIYTTHMDHLRRTPPPASPQPREVTFLSFSLSWEEMFYAQKCHCFLTDIILDSIRQND PKAITAKVVSLVNQLWTLHISPKQFVVDLLAITGFKDDRHTQERLYSWVELTLPFARKYG RCVDLLIQRGLSKSVSYSVLSKYLQDG
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Kctd19del/del spermatocytes failed to complete meiosis, leading to azoospermia.
Bibliography 1.Teng, X., Aouacheria, A., Lionnard, L., Metz, K. A., Soane, L., Kamiya, A., & Hardwick, J. M. (2019). KCTD: A new gene family involved in neurodevelopmental and neuropsychiatric disorders. CNS neuroscience & therapeutics, 25(7), 887–902. https://doi.org/10.1111/cns.13156 2Oura S, Koyano T, Kodera C, Horisawa-Takada Y, Matsuyama M, Ishiguro KI, Ikawa M. KCTD19 and its associated protein ZFP541 are independently essential for meiosis in male mice. PLoS Genet. 2021 May 7;17(5):e1009412. doi: 10.1371/journal.pgen.1009412. PMID: 33961623; PMCID: PMC8104389.