Search by BoMiProt ID - Bomi4330


Primary Information

BoMiProt ID Bomi4330
Protein Name BSD domain-containing protein 1
Organism Bos taurus
Uniprot IdQ3SX22
Milk FractionWhey
Ref Sequence Id NP_001030198.1
Aminoacid Length 461
Molecular Weight 50343
Fasta Sequence https://www.uniprot.org/uniprot/Q3SX22.fasta
Gene Name BSDC1
Gene Id 505545
Protein Existence Status reviewed

Secondary Information

Biochemical Properties BSD domain.BSD domain appears to be ∼60 amino acids in length.presence of three α helices, which probably form a three-helical bundle in small domains.
PTMs phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SX22|BSDC1_BOVIN BSD domain-containing protein 1 OS=Bos taurus OX=9913 GN=BSDC1 PE=2 SV=1 MEPGGDGAEDDVGAGIGPPAPGWCLRGRCRVGSQREDVGWWRSWLQQSYQAVKEKSSEAL EFMKRDLTEFTQVVQRDTACTIAATASVVKEKLTTEGSSGATEKMKKGLSDFLGVISDTF APS*123PDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYCNEPDGPPELFDAWLSQ FCLEEKKGEISELLVGS*197PSIRALYTKMVPAAVSHSEFWHRYFYKVHQLEQEQARRDALKQ RAEQSISEEPGWEEEEEELAGVSPTSLKEAKVPVARPSTSPEGGPGPQSPCEENLVTPVE PPTEVTPSESSESVSLVTQIAKPPPASEAPALPKDLSQKLLEASLEEQDLAVDTGETGPP PRAQSKPHTPACRPSGPEPRPPARVET*387LREEILTDLRVFELNSDSGKSTPSNNGKKGS*418S*419T DISEDWEKDFDLDMTEEEVQMALSKVDAS449GELEDVEWEDWD
Predicted Disorder Regions 1-22, 92-106, 160-172, 232-461
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Doerks T, Huber S, Buchner E, Bork P. BSD: a novel domain in transcription factors and synapse-associated proteins. Trends Biochem Sci. 2002 Apr;27(4):168-70. doi: 10.1016/s0968-0004(01)02042-4. PMID: 11943536.