Search by BoMiProt ID - Bomi4319


Primary Information

BoMiProt ID Bomi4319
Protein Name BRISC and BRCA1-A complex member 2/BRCA1-A complex subunit BRE/BRCA1/BRCA2-containing complex subunit 45/Brain and reproductive organ-expressed protein
Organism Bos taurus
Uniprot IdA6QQW8
Milk FractionExosomes,MFGM
Ref Sequence Id NP_001095744.1
Aminoacid Length 383
Molecular Weight 43561
Fasta Sequence https://www.uniprot.org/uniprot/A6QQW8.fasta
Gene Name BABAM2/BRE
Gene Id 614152
Protein Existence Status reviewed

Secondary Information

Protein Function Participate in double stand break,negative regulation of apoptosis,Chromatin organisation.
PTMs Acetylation,Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QQW8|BABA2_BOVIN BRISC and BRCA1-A complex member 2 OS=Bos taurus OX=9913 GN=BABAM2 PE=2 SV=1 MS*2PEVALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRFKLHI PYAGETLKWDIIFNAQYPELPPDFIFGEDAEFLPDPSALHNLASWNPSNPECLLLVVKEL VQQYHQFQCSRLRESSRLMFEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVD FSNIPTYLLKDVNEDPGEDVALLSVSFEDTEATQVYPKLYLSPRIEHALGGSSALHIPAF PGGGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTKLTLL LMWKDFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQLYSQAQKNYPYSPRWDGNEMAK RAKAYFKTFVPQFQEAAFANGKL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices