Search by BoMiProt ID - Bomi4318


Primary Information

BoMiProt ID Bomi4318
Protein Name BRISC and BRCA1-A complex member 1/Mediator of RAP80 interactions and targeting subunit of 40 kDa/New component of the BRCA1-A complex
Organism Bos taurus
Uniprot IdQ08E57
Milk FractionWhey
Ref Sequence Id NP_001070269.1
Aminoacid Length 332
Molecular Weight 36886
Fasta Sequence https://www.uniprot.org/uniprot/Q08E57.fasta
Gene Name BABAM1/MERIT40/NBA1
Gene Id 504517
Protein Existence Status reviewed

Secondary Information

Protein Function The breast cancer associated gene 1 (BRCA1)-A protein complex assembles at DNA damage-induced nuclear foci to facilitate repair of double-stranded breaks. 
Biochemical Properties  BRCA1 A complex bears striking similarities to the 19S proteasome complex. Furthermore, we show that four members of the BRCA1-A complex possess a polyubiquitin chain-binding capability, thus forming a complex that might facilitate the deubiquitinating activity of the deubiquitination enzyme BRCC36 or the E3 ligase activity of the BRCA1/BARD1 ligase.
PTMs N-Linked Acetylation at Meth,Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08E57|BABA1_BOVIN BRISC and BRCA1-A complex member 1 OS=Bos taurus OX=9913 GN=BABAM1 PE=2 SV=1 MEVAEPSCPTEEEEEEEEEEEQSAEPRPRTRS*32NPEGAEDRALGAQTSVGSRS*52EGEGEAAS*60ADDGTANPPGAGPKPWQVPPPAPEVQVRTPRVNCPEKVIICLDLSEEMALPKLESFNGSK TNALNVSQKMIEMFVRTKHKIDKSHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETAS CSTFNLEGLFSLIQQKTELPVTENVQTIPPPYVVRTILVYSRPPCQPQFSLTEPMKKMFQ CPYFFFDVVYIHNGADEKEEEMSWKDMFAFMGSLDTKGTSYKYEVALAGPALELHNCMAK LLAHPLQRPCQSHASYSLLEEDDEATEVEATV
Predicted Disorder Regions 1-91, 318-332
DisProt Annotation
TM Helix Prediction no TM helices
Additional Comments NBA1 is a component of the BRCA1 A complex, which also contains Brca1/Bard1, Abra1, RAP80, BRCC36, and BRE. NBA1 is required to maintain BRE and Abra1 abundance and for the recruitment of BRCA1 to sites of DNA damage.
Bibliography 1.Mok MT, Henderson BR. The in vivo dynamic organization of BRCA1-A complex proteins at DNA damage-induced nuclear foci. Traffic. 2012 Jun;13(6):800-14. doi: 10.1111/j.1600-0854.2012.01355.x. Epub 2012 Apr 8. PMID: 22420687. 2.Wang B, Hurov K, Hofmann K, Elledge SJ. NBA1, a new player in the Brca1 A complex, is required for DNA damage resistance and checkpoint control. Genes Dev. 2009 Mar 15;23(6):729-39. doi: 10.1101/gad.1770309. Epub 2009 Mar 4. PMID: 19261749; PMCID: PMC2661606.