Search by BoMiProt ID - Bomi4313


Primary Information

BoMiProt ID Bomi4313
Protein Name Breast cancer type 1 susceptibility protein homolog/RING-type E3 ubiquitin transferase BRCA1
Organism Bos taurus
Uniprot IdQ864U1
Milk FractionWhey,MFGM
Ref Sequence Id NP_848668.1
Aminoacid Length 1849
Molecular Weight 206279
Fasta Sequence https://www.uniprot.org/uniprot/Q864U1.fasta
Gene Name BRCA1
Gene Id 353120
Protein Existence Status reviewed

Secondary Information

Protein Function tumor suppressor genes,contribute to DNA repair and transcriptional regulation in response to DNA damage.
Significance in milk Its Presence in milk is important for mastitis resistance in cattle.
PTMs Phosphorylation,Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q864U1|BRCA1_BOVIN Breast cancer type 1 susceptibility protein homolog OS=Bos taurus OX=9913 GN=BRCA1 PE=1 SV=1 MDLSADHVEEVQNVLNAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ CPLCKNDITKRSLQESTRFSQLVEELLKIIHAFELDTGLQFANSYNFSRKEDNS*114PEHLKE EVSIIQSMGYRNRAKRLWQSEPENPTLQETSLTVELSNLGIVRSLRTKQQTQSQNKSVYI ELGSDSSEDTVNKASYFSVGDHELLEITPQGAKAKTNLNPAEKAACEFSEKDITNTEHHQ LSIKDLITTQKHATETHPEKYQGISVSDFHVEPCGTDTHASSLQHENSSLLLTENRLNVE KAEFCNKSKQPVLVKSQQSRWAESKGTCKDRQIPSTEKKIVLNTDPLYRRKELRKQKPAC PDSPGDSQDVPWVTLNNSIQKVNDWFSRSDEILTS*395DDS*398CDGGSESNNEVAGAVEIPNKVD GYS*423GSSEKINLMAS*434DPHGTLIHERVHSKPVESNIEDKIFGKTYRRKSSLPNFSHIAEDLI LGAFTVEPQITQEQPLTNKLKCKRRGTSGLQPEDFIKKVDLTIVPKTPEKMTEGTDQTEQ KCHGMNITSDGHENKTKRDYVQKEQNANPAESLEKESVFRTEAEPISISISNMELELNIH RSKAPKNRLKRKSSTRKIPELELVVSRNPSLPNHTELPIDSSSSNEEMKKKHSSQMPVRQ SQKLQLIGDKELTAGAKNNKTYEQINKRLAS*691DAFPELKLTNTPGYFTNCSS*711KPEEFVHPS*720 LQREENLGTIQVSNSTKDPKDLILREGKALQIERSVESTNISLVPDTDYSTQDSISLLEA KTPEKAKTAPNPCVSLCTATKNLKELIHRDFKDTKNNTEGFQDLLGHDINYVIQETSREM EDSELDTQYLQNTFKASKRQTFALFSNPGNPQKECATVFAHSGSLRDQSPRDPLKCRQKE DSQGKSESKSQHVQAICTTVHFPVADQQDRTPGDDAKCSAKEVTRVCQSSQLRGHKTELV FANKQGVSEKPNLIPSLSPIKS*982SVKTICKKSPSEKFEEPVTS*1002PEKTLGSESIIQSAVSTI SQNNIQESTFKEVSSNSVNEVGSSTNEVGSSVNEVGSSGENIQAEPGRNREPKLRALLGL GLTQPEVYKQSLPVSNCHHPEIKRQGENEDMPQAVKADFSPCLISDNLEQPTGSRHAS*1138QV CSETPDNLLNDDEIKENSHFAESDIKERSAVFSESVQKGEFRGS*1184PGPFTHTHLAQGHQRG AGKLESEETVS*1211S*1212EDEELPCFQQLLFGKVTSTLSPSTGCNTVATEGLSKETEGNLESLKSG LNDCSGQVTSAKVS*1274QEHHLNEEARCSGSLFSSQCSAMEDLTTNTNTQDPFLMFERPSKQV YQS*1323ESEEVLS*1330DKELVS*1336DDEERETGLEEDSCQEEQSVDSDLGEAVSDHVSETSLSEDGVGL SS*1382QSDILTT*1389QQRDTMQDNLLKLQQEMAELEAVLERHGS*1418QPSHSSASLTADSRGPEHLLNL EQDTSERAILTS*1452EKSRDYSRSQNPESLSADKFPVSLDSSTNKNKEPGMERSSASKFQLSY NRWYMHSSRSLQDRNCPS*1518QKEPINVADMEEQQLAKREAQDLMGSFLPRQDQEGTPYLKSG ISLFSHEPESDPSEDRAAEPAHVHSMPPSASALKLSQFRVEESTKNPAAAHIANTTRCNL REESMSKEKPEVISSTERSKKRLSMVASGLTPKELMLVQKFARKHHVTLTNLITEETTHV IMKTDPEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKEGKMLDEHDFEVRGDVVNGRNHQ GPKRARESRDKKIFKGLEICCYGPFTNMPTDQLEWMVQLCGASVVKEPSSFTPDQGTHPV VVVQPDAWTEDAGFHVIGQMCEAPVVTREWVLDSVALYQCQELDTYLVP
Predicted Disorder Regions 2 predicted disordered segments; (182-940), (987-1627)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs BRCA1 is hyperphosphorylated in response to DNA damage and relocated to sites of replication forks marked by proliferating cell nuclear antigen (PCNA).In response to ionizing radiation, BRCA1 is bound and phosphorylated by an ataxia-telangiectasia mutated (ATM) kinase.The major target for ATM phosphorylation after ionizing radiation is Ser1387 of BRCA1. In response to UV irradiation, Ser1457 is primarily phosphorylated, mainly by ATM-related kinase (ATR).The G2/M control kinase, CHK2, has been shown to phosphorylate BRCA1 at Ser988 on exposure to ionizing radiation. Ser1423 and Ser1524 are also phosphorylated in response to DNA damage.Lys63, Lys48 and Lys6 polyubiquitin chains can be conjugated to BRCA1.. “Substrate-specific” monoubiquitination by the E2s UbcH6, Ube2e2, UbcM2, Ube2w and UbcH5 result in the conjugation of a single Ub residue to BRCA1.“Ubiquitin-specific” E2s, Ubc13, Ube2k and UbcH5 recognize monoubiquitinated BRCA1 and stimulate the conjugation of Lys6, Lys48, and Lys63 polyubiquitin chains to BRCA1.
Bibliography 1.Yoshida K, Miki Y. Role of BRCA1 and BRCA2 as regulators of DNA repair, transcription, and cell cycle in response to DNA damage. Cancer Sci. 2004 Nov;95(11):866-71. doi: 10.1111/j.1349-7006.2004.tb02195.x. PMID: 15546503. 2.Yuan Z, Chu G, Dan Y, Li J, Zhang L, Gao X, Gao H, Li J, Xu S, Liu Z. BRCA1: a new candidate gene for bovine mastitis and its association analysis between single nucleotide polymorphisms and milk somatic cell score. Mol Biol Rep. 2012 Jun;39(6):6625-31. doi: 10.1007/s11033-012-1467-5. Epub 2012 Feb 12. PMID: 22327776.