Search by BoMiProt ID - Bomi4311


Primary Information

BoMiProt ID Bomi4311
Protein Name Breast cancer metastasis-suppressor 1-like protein
Organism Bos taurus
Uniprot IdA4FV29
Milk FractionWhey
Ref Sequence Id NP_001076897.1
Aminoacid Length 323
Molecular Weight 37629
Fasta Sequence https://www.uniprot.org/uniprot/A4FV29.fasta
Gene Name BRMS1L
Gene Id 514432
Protein Existence Status reviewed

Secondary Information

Protein Function a component of Sin3A-histone deacetylase (HDAC) co-repressor complex,Involved in the histone deacetylase (HDAC1)-dependent transcriptional repression activity.suppress the transcriptional activity of FZD10 promoter.
PTMs Isopeptide bond formation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A4FV29|BRM1L_BOVIN Breast cancer metastasis-suppressor 1-like protein OS=Bos taurus OX=9913 GN=BRMS1L PE=2 SV=1 MPVHSRGDKKETNHHDEMEVDYAENEGSSSEDEDTESSSVSEDGDSSEMDDEDCERRRME CLDEMSNLEKQFTDLKDQLYKERLSQVDAKLQEVIAGKAPEYLEPLATLQENMQIRTKVA GIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELEEKIRRLEEDRHSIDITSE LWNDELQSRKKRKDPFS*197PDKKKPVVVSGPYIVYMLQDLDILEDWTTIRKAMATLGPHRVK TEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKR PDGSKSKLYISQLQKGKYSIKHS
Predicted Disorder Regions 1-71, 96-107, 184-204, 234-254, 306-323
DisProt Annotation
TM Helix Prediction no TM helices
Significance of PTMs serine residue immediately upstream of the critical metastasis suppressor domain of BRMS1L is found to be phosphorylated by Cyclin Dependent Kinase 2 (CDK2).Phosphorylation status at S237 regulates BRMS1 protein interactions related to a variety of biological processes, phenotypes [cell cycle (e.g., CDKN2A), DNA repair (e.g., BRCA1)], and metastasis [(e.g., TCF2 and POLE2)]. Presence of S237 also directly decreased MDA-MB-231 breast carcinoma migration in vitro and metastases in vivo.
Additional Comments Ectopic expression of BRMS1L inhibited cancer cell invasion and migration; knockdown of BRMS1L by siRNA induced the opposite effect. reduced BRMS1L in breast cancer tissues is associated with metastasis and poor patient survival
Bibliography 1.Zimmermann RC, Sardiu ME, Manton CA, Miah MS, Banks CAS, Adams MK, Koestler DC, Hurst DR, Edmonds MD, Washburn MP, Welch DR. Perturbation of BRMS1 interactome reveals pathways that impact metastasis. PLoS One. 2021 Nov 17;16(11):e0259128. doi: 10.1371/journal.pone.0259128. PMID: 34788285; PMCID: PMC8598058.