Search by BoMiProt ID - Bomi4300


Primary Information

BoMiProt ID Bomi4300
Protein Name BRCA1-A complex subunit Abraxas 1/Coiled-coil domain-containing protein 98/Protein FAM175A
Organism Bos taurus
Uniprot IdQ5E9P1
Milk FractionWhey,MFGM
Ref Sequence Id NP_001015516.1
Aminoacid Length 410
Molecular Weight 46184
Fasta Sequence https://www.uniprot.org/uniprot/Q5E9P1.fasta
Gene Name ABRAXAS1/ABRA1/CCDC98/FAM175A
Gene Id 504796
Protein Existence Status reviewed

Secondary Information

Protein Function it is a tumour-suppressor gene in the BRCA pathway that displays mutations or copy number loss in several human cancers.
Biochemical Properties The NLS domain is important for translocation of BRCA1-A complexes into the cell nucleus to DNA damage sites.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5E9P1|ABRX1_BOVIN BRCA1-A complex subunit Abraxas 1 OS=Bos taurus OX=9913 GN=ABRAXAS1 PE=2 SV=1 MEGESTTAVLSGFVLGALAFQHLNTDSDTEGFLLGEVKGEAKNSITDS*48QMDDVEVIYTID IQKYISCYQLFSFYNSSGEVNEQALKKILSNVKKDVVGWYKLRRHSDQIMTFRERLLHRN LQQHLSSQELVFLLLTPSIITESCSTHRLEHALYKPQKGLFHRIPLVVANLGMSEQLGYK TTSGSCTSAGFSRAVKTHSSEFFKEDGSLKEVQKINEMYTSLQDELKSICEKVEHSERAV EKLLNDVNRLKGEIKKRKQAQMQATREKNVQKDPQENILLCQALRTFFPDCELLHSCVIS LKNRRISGSSCTTTHPLSGVDNLTLMVEYTDFPEASPARSALLVTKRKASDTDDGWQFKK SRLGGIQNRPSKTDTNSSNQEQASTVS*387S*388PET*391DEEIERMKGSGEYPQS*407PTF
Predicted Disorder Regions 257-272, 343-410
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs ABRAXAS1 acts as the central scaffold protein of the BRCA1- A complex, which is comprised of BRCA1, ABRAXAS1, MERIT40, RAP80, BRCC45 and BRCC36 . When phosphorylated at its pSPxF motif, ABRAXAS1 is being bound by the C-terminal domain of BRCA1.
Bibliography 1.Castillo, A., Paul, A., Sun, B., Huang, T.H., Wang, Y., Yazinski, S.A., Tyler, J., Li, L., You, M.J., Zou, L. et al. (2014) The BRCA1- interacting protein Abraxas is required for genomic stability and tumor suppression. Cell Rep., 8, 807–817. 2.Solyom, S., Aressy, B., Pylkäs, K., Patterson-Fortin, J.,