Primary Information |
---|
BoMiProt ID | Bomi4292 |
---|
Protein Name | BPI fold-containing family B member 1/Long palate, lung and nasal epithelium carcinoma-associated protein 1/von Ebner minor salivary gland protein/VEMSGP |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q8SPF8 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_777122.1 |
---|
Aminoacid Length | 473 |
---|
Molecular Weight | 51700 |
---|
FASTA Sequence |
Download |
---|
Gene Name | BPIFB1/LPLUNC1 |
---|
Gene ID | 282643 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | BPIFB1 is abnormally expressed in nasopharyngeal carcinoma (NPC), gastric cancer, and other cancer tissues, regulate chronic infections and inflammation, indicating that it may play an important role in the development of tumors. |
---|
Biochemical Properties | BPIFB1 has well-recognized roles in sensing and responding to Gram-negative bacteria due to its structural similarity with BPI protein and lipopolysaccharide (LPS)-binding protein, both of which are innate immune molecules with recognized roles in sensing and responding to Gram-negative bacteria, so it can regulate cystic fibrosis (CF), chronic obstructive pulmonary disease (COPD), asthma, and other respiratory diseases. |
---|
PTMs | Glycosylation at Asn |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q8SPF8|BPIB1_BOVIN BPI fold-containing family B member 1 OS=Bos taurus OX=9913 GN=BPIFB1 PE=2 SV=1
MAYPWTFTFLCGLLAANLVGATLSPPVVLSLSTEVIKQMLAQKLKNHDVTNTLQQLPLLT
AMEEESSRGIFGNLVKSILKHILWMKVTSASIGQLQVQPLANGRQLMVKAPLDVVAGFNV
PLFKTVVELHVEVEAQAIIHVETREKDHARLVLSECSNTGGSLRVSLLHKLSFLLKCLAD
KVISLLTPAPPKLVKSELCPVLKAGFEDMRGELLN*215LTKVPMSLNSEHLKLDFISPVIDHS
VVHLILGARLFNSEGKVTKLFNVAGDSLNLPTLNQTPFRLTVRKDVVVAIIAALIHSGKL
TVLLDYVLPEVARQLRSSIKVIDETAAAQLGPTQIVKIMSQTTPMLILDQGNAKVAQLIV
LEIFATDKDSRPLFTLGIEASSDIQFYVEDGLLVFSFNEIRADRIHLMNSDIGVFNPKLL
NN*422ITTKILTSILLPNENGKLRSGIPVSMVKNLGFKSISLSLTKEALVVTQASS
|
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | 1TMH; (7-29) |
---|
Significance of PTMs | BPIF, although highly glycosylated, is expressed differently in different species or at different locations within the same species. |
---|
Additional Comments | BPIFB1 protein is most highly expressed in the trachea, followed by the lung, and weakly expressed in salivary glands, the duodenum, and the stomach. |
---|
Bibliography | Li J, Xu P, Wang L, Feng M, Chen D, Yu X, Lu Y. Molecular biology of BPIFB1 and its advances in disease. Ann Transl Med. 2020 May;8(10):651. doi: 10.21037/atm-20-3462. PMID: 32566588; PMCID: PMC7290611. |