Primary Information |
|---|
| BoMiProt ID | Bomi4289 |
|---|
| Protein Name | BPI fold-containing family A member 1/Palate lung and nasal epithelium clone protein |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q8SPU5 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_776851.1 |
|---|
| Aminoacid Length | 255 |
|---|
| Molecular Weight | 26576 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | BPIFA1/PLUNC |
|---|
| Gene ID | 281989 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | an airway host-protective protein with immunomodulatory properties that binds to LPS and is regulated by infectious and inflammatory signals. to inhibit bacterial and viral proliferation, regulate ion transport, and work as a surfactant |
|---|
| PTMs | Disulfide bond formation,Glycosylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q8SPU5|BPIA1_BOVIN BPI fold-containing family A member 1 OS=Bos taurus OX=9913 GN=BPIFA1 PE=2 SV=1
MFHIGSLVVLCGLLAPTTALLEALPTPLGQTLPLAVTPALAPSPPDLAGSLTGALSNGLL
SEGLLGILENLPLLDILKTRGNAPSGLLGSLLGKVTSLTPLLNNIIELKITNPQLLELGL
VQSPDGHRLYVTIPLGMILNVKTSLVGSLLKLAVKLN*157ITVELLAVTDEQKHVHLVVGN*178CT
HSPGSLQIFLLDGLGSLPIQSFVDN*205LTGILNDVLPGLVQGKVCPLVNAVLSRLDVTLVHS
IVNALIHGLQFVIKV
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Britto CJ, Niu N, Khanal S, Huleihel L, Herazo-Maya JD, Thompson A, Sauler M, Slade MD, Sharma L, Dela Cruz CS, Kaminski N, Cohn LE. BPIFA1 regulates lung neutrophil recruitment and interferon signaling during acute inflammation. Am J Physiol Lung Cell Mol Physiol. 2019 Feb 1;316(2):L321-L333. doi: 10.1152/ajplung.00056.2018. Epub 2018 Nov 21. PMID: 30461288; PMCID: PMC6397348. |
|---|
