Search by BoMiProt ID - Bomi4289


Primary Information

BoMiProt ID Bomi4289
Protein Name BPI fold-containing family A member 1/Palate lung and nasal epithelium clone protein
Organism Bos taurus
Uniprot IdQ8SPU5
Milk FractionWhey
Ref Sequence Id NP_776851.1
Aminoacid Length 255
Molecular Weight 26576
Fasta Sequence https://www.uniprot.org/uniprot/Q8SPU5.fasta
Gene Name BPIFA1/PLUNC
Gene Id 281989
Protein Existence Status reviewed

Secondary Information

Protein Function an airway host-protective protein with immunomodulatory properties that binds to LPS and is regulated by infectious and inflammatory signals. to inhibit bacterial and viral proliferation, regulate ion transport, and work as a surfactant
PTMs Disulfide bond formation,Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q8SPU5|BPIA1_BOVIN BPI fold-containing family A member 1 OS=Bos taurus OX=9913 GN=BPIFA1 PE=2 SV=1 MFHIGSLVVLCGLLAPTTALLEALPTPLGQTLPLAVTPALAPSPPDLAGSLTGALSNGLL SEGLLGILENLPLLDILKTRGNAPSGLLGSLLGKVTSLTPLLNNIIELKITNPQLLELGL VQSPDGHRLYVTIPLGMILNVKTSLVGSLLKLAVKLN*157ITVELLAVTDEQKHVHLVVGN*178CT HSPGSLQIFLLDGLGSLPIQSFVDN*205LTGILNDVLPGLVQGKVCPLVNAVLSRLDVTLVHS IVNALIHGLQFVIKV
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Britto CJ, Niu N, Khanal S, Huleihel L, Herazo-Maya JD, Thompson A, Sauler M, Slade MD, Sharma L, Dela Cruz CS, Kaminski N, Cohn LE. BPIFA1 regulates lung neutrophil recruitment and interferon signaling during acute inflammation. Am J Physiol Lung Cell Mol Physiol. 2019 Feb 1;316(2):L321-L333. doi: 10.1152/ajplung.00056.2018. Epub 2018 Nov 21. PMID: 30461288; PMCID: PMC6397348.