Search by BoMiProt ID - Bomi4216


Primary Information

BoMiProt ID Bomi4216
Protein Name Barrier-to-autointegration factor
Organism Bos taurus
Uniprot IdP61283
Milk FractionExosomes
Ref Sequence Id NP_892033.1
Aminoacid Length 89
Molecular Weight 10059
Fasta Sequence https://www.uniprot.org/uniprot/P61283.fasta
Gene Name BANF1
Gene Id 360196
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells  vertebral column
Protein Function Barrier-to-Autointegration Factor (BAF), a DNA-binding protein involved in post-mitotic NE reformation and cytosolic viral regulation, as an essential protein for nuclear rupture repair. 
Biochemical Properties BAF forms obligate dimers, with each monomer binding to dsDNA (hereafter referred to simply as DNA) in a sequence-independent manner, allowing for the looping and condensation of DNA through intramolecular cross-bridging. Along with DNA, BAF also binds to the LAP2-Emerin-MAN1 (LEM) domain, a motif found in a family of proteins known collectively as the LEM-domain proteins of the INM, ER, and nucleoplasm.
PTMs N-acetylation at Meth,Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P61283|BAF_BOVIN Barrier-to-autointegration factor OS=Bos taurus OX=9913 GN=BANF1 PE=3 SV=1 MT*2T*3S*4QKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFR EWLKDTCGANAKQSRDCFGCLREWCDAFL
Predicted Disorder Regions (1-20)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation on Thr-2; Thr-3 and Ser-4 disrupts its ability to bind DNA and reduces its ability to bind LEM domain-containing proteins.
Bibliography 1.Halfmann CT, Roux KJ. Barrier-to-autointegration factor: a first responder for repair of nuclear ruptures. Cell Cycle. 2021 Apr;20(7):647-660. doi: 10.1080/15384101.2021.1892320. Epub 2021 Mar 8. PMID: 33678126; PMCID: PMC8078722. 2.Skoko D, Li M, Huang Y, et al. Barrier-to-autointegration factor (BAF) condenses DNA by looping. Proc Natl Acad Sci U S A. 2009;106:16610–16615. 3.Lee KK, Haraguchi T, Lee RS, et al. Distinct functional domains in emerin bind lamin A and DNA-bridging protein BAF. J Cell Sci. 2001;114:4567–4573.