Search by BoMiProt ID - Bomi4155


Primary Information

BoMiProt ID Bomi4155
Protein Name ATP-binding cassette sub-family F member 2
Organism Bos taurus
Uniprot IdQ2KJA2
Milk FractionWhey
Ref Sequence Id NP_001039601.1
Aminoacid Length 625
Molecular Weight 71475
Fasta Sequence https://www.uniprot.org/uniprot/Q2KJA2.fasta
Gene Name ABCF2
Gene Id 513061
Protein Existence Status reviewed

Secondary Information

Protein Function cytoprotective and antiapoptotic role.a binding partner of ACTN4,regulation of cell volume and anion channels in epithelial cells.
Biochemical Properties functional antioxidant response element (ARE) in its promoter region.consists of NH2 actin binding domain,spectrin like repeat domain,EF Hand type calcium binding domain at C terminal.NH2 terminal is imp for binding to ACTN4.contain NBDs and no putative transmembrane domain.
PTMs Acetylation on Lys, Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KJA2|ABCF2_BOVIN ATP-binding cassette sub-family F member 2 OS=Bos taurus OX=9913 GN=ABCF2 PE=2 SV=1 MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDAITEPQVAEERNEEANGRETTEVDLLTK ELEDFEMKKAAARAVTGVLASHPNSTDAHIINLSLTFHGQELLSDTKLELNSGRRYGLIG LNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLQCVMEVDTERAMLEREAER LAHEDAECEKLLELYERLEELDADKAEMRASRILHGLGFT*220PAMQRKKLKDFSGGWRMRVA LARALFIRPFMLLLDEPTNHLDLDACVWLEEELKTFKRILVLVSHSQDFLNGVCTNIIHM HNKKLKYYTGNYDQYVKTRLELEENQMKRFHWEQDQIAHMKNYIARFGHGSAKLARQAQS KEKTLQKMMASGLTERVVSDKTLSFYFPPCGKIPPPVIMVQNVSFKYTKDGPCIYNNLEF GIDLDTRVALVGPNGAGKSTLLKLLTGELLPTDGMIRKHSHVKIGRYHQHLQEQLDLDLS PLEYMMKCYPEIKEKEEMRKIIGRYGLTGKQQVS*514PIRNLSDGQKCRVCLAWLAWQNPHML FLDEPTNHLDIETIDALADAINDFEGGMMLVSHDFRLIQQVAQEIWVCEKQTITKWPGDI LAYKEHLKSKLVGEEPQPTRRTHNV
Predicted Disorder Regions (1-81)
DisProt Annotation
TM Helix Prediction no TM helices
Significance of PTMs reported to contribute to chemoresistance in clear cell ovarian cancer.
Bibliography Ando-Akatsuka Y, Shimizu T, Numata T, Okada Y. Involvements of the ABC protein ABCF2 and α-actinin-4 in regulation of cell volume and anion channels in human epithelial cells. J Cell Physiol. 2012 Oct;227(10):3498-510. doi: 10.1002/jcp.24050. PMID: 22252987.