Search by BoMiProt ID - Bomi4054


Primary Information

BoMiProt ID Bomi4054
Protein Name Aspartate--tRNA ligase, cytoplasmic/Aspartyl-tRNA synthetase/AspRS
Organism Bos taurus
Uniprot IdQ3SYZ4
Milk FractionWhey
Ref Sequence Id NP_001030257.1
Aminoacid Length 501
Molecular Weight 57036
Fasta Sequence https://www.uniprot.org/uniprot/Q3SYZ4.fasta
Gene Name DARS1
Gene Id 510162
Protein Existence Status reviewed

Secondary Information

Protein Function A tRNA modification factor.Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.
Biochemical Properties isoelectric point is 4.96 with a mol mass of 66,599kD.Cellular localization is Cytoplasm.
PTMs Acetylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SYZ4|SYDC_BOVIN Aspartate--tRNA ligase, cytoplasmic OS=Bos taurus OX=9913 GN=DARS1 PE=2 SV=1 MPSANASRRSQEKPREIMDAAEDYAKERYGVSSMIQSQEKPDRVLVRISDLT*52VQKAGEVV WVRARVHTSRAKGKQCFLVLRQQQFNVQALVAVGDHASKQMVKFAANINKESIVDVEGVV RKVNQKIGSCTQQDVELHVQKIYVISSAEPRLPLQLDDAVRPEVEGEEEGRATVNQDTRL DNRVIDLRTSTSQAIFRLQSGICHPFRETLTNKGFVEIQTPKIISAASEGGANVFTVSYF KNNAYLAQS*249PQLYKQMCICADFEKVFCIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYH EVVEEIADTLVQIFKGLQKRFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGI EMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKQSNSYDMFM RGEEILSGAQRIHDPQLVTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLF LGLHNVRQTSMFPRDPKRLT*500P
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Cunha AF, Andrade HM, Souza FN, Fialho Júnior LC, Rosa DLSO, Ramos Sanchez EM, Gidlund M, Goto H, Brito MAVP, Guimarães AS, Lage AP, Reis LC, Della Libera AMMP, Heinemann MB, Cerqueira MMOP. Comparison of antibody repertories against Staphylococcus aureus in healthy and infected dairy cows with a distinct mastitis history and vaccinated with a polyvalent mastitis vaccine. J Dairy Sci. 2020 May;103(5):4588-4605. doi: 10.3168/jds.2019-17084. Epub 2020 Feb 26. PMID: 32113759.