Search by BoMiProt ID - Bomi4053


Primary Information

BoMiProt ID Bomi4053
Protein Name Aspartate beta-hydroxylase domain-containing protein 1
Organism Bos taurus
Uniprot IdA1L515
Milk FractionWhey
Ref Sequence Id NP_001075210.1
Aminoacid Length 367
Molecular Weight 38661
Fasta Sequence https://www.uniprot.org/uniprot/A1L515.fasta
Gene Name ASPHD1
Gene Id 614735
Protein Existence Status reviewed

Secondary Information

Protein Function enable dioxygenase activity.involved in peptidyl-amino acid modification
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A1L515|ASPH1_BOVIN Aspartate beta-hydroxylase domain-containing protein 1 OS=Bos taurus OX=9913 GN=ASPHD1 PE=2 SV=1 MWRGSSAGGSQGAAMEGTGGELGGQGNWGLEDAPGLLARASLPIMPAWPLPLASSALTLL LGALTSLFLWYCYRLGSQDMQALGTGSRAGAVGGRPGGCSEAGRPS*106PGRSGESGEGPRTE GLMSRRLRAYARRYSWAGMGRVRRAAQGGPSPGGGPGVLGIQRPGLLFLPDLPSAPFVPR EAQRHDVELLESSFPAILRDFGAVSWDFSGTTPPPRGWSPPLAPGCYQLLLYQAGRCQPS NCRRCPGAYRALRGLRSFMSANTFGNAGFSVLLPGARLEGRCGPTNARVRCHLGLKIPPG CELVVGGEPQCWAEGHCLLVDDSFLYTVAHNGSPEDGPRVVFIVDLWHPNVAGAERQALD FVFAPDP
Predicted Disorder Regions 3 (1-29), (89-122), (145-157)
DisProt Annotation
TM Helix Prediction No TM helices