Search by BoMiProt ID - Bomi4052


Primary Information

BoMiProt ID Bomi4052
Protein Name Aspartate aminotransferase, mitochondrial
Organism Bos taurus
Uniprot IdP12344
Milk FractionWhey
Ref Sequence Id NP_777231.1
Aminoacid Length 430
Molecular Weight 47514
Fasta Sequence https://www.uniprot.org/uniprot/P12344.fasta
Gene Name GOT2
Gene Id 286886
Protein Existence Status reviewed

Secondary Information

Protein Function AST is the only enzyme, which supply of this amino acid as a substrate for many metabolic processes, such as urea cycle or purine and pyrimidine nucleotides in the liver, synthesis of L-arginine in the kidney and purine nucleotide cycle in the brain and the skeletal muscle. AST is also involved in D-aspartate production that regulates the metabolic activity at the auto-, para- and endocrine level.
Biochemical Properties There are two aspartate aminotransferase isoforms--cytoplasmic (AST1) and mitochondrial (AST2), that usually occur together and interact with each other metabolically. Both isoforms are homodimers containing highly conservative regions responsible for catalytic properties of enzyme. The common feature of all aspartate aminotransfeses is Lys - 259 residue covalent binding with prosthetic group - pyridoxal phosphate. The differences in the primary structure of AST isoforms determine their physico-chemical, kinetic and immunological properties. 
PTMs Acetylation, Methylation, Nitration, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P12344|AATM_BOVIN Aspartate aminotransferase, mitochondrial OS=Bos taurus OX=9913 GN=GOT2 PE=1 SV=2 MALLHSGRFLSGVAAAFHPGLAAAASARASSWWAHVEMGPPDPILGVT*48EAFKRDTNSKKM NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEY*96LPIAGLAEFCKASAELALGENNEV LKSGRYVTVQTISGTGALRIGAS*143FLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQSYR YYDPKTCGFDFTGAIEDISKIPAQSVILLHACAHNPTGVDPRPEQWKEMATVVKKNNLFA FFDMAYQGFASGDGNKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEE AKRVESQLKILIRPMYSNPPINGARIASTILTSPDLRKQWLHEVKGMADRIISMRTQLVS NLKKEGSSHNWQHIIDQIGMFCYTGLKPEQVERLTKEFSIYMTKDGRISVAGVTSGNVAY LAHAIHQVTK
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Aspartate aminotransferase is a part of the malate-aspartate shuttle in the myocardium, is involved in gluconeogenesis in the liver and kidney, glyceroneogenesis in the adipose tissue, and synthesis of neurotransmitters and neuro-glial pathway in the brain. 
Bibliography 1.Mehta, P. K., Hale, T. I. & Christen, P. (1989). Evolutionary Relationships Among Aminotransferases: Tyrosine Aminotransferase, Histidinol Phosphate Aminotransferase, and Aspartate Aminotransferase are Homologous Proteins. Eur. J. Biochem. 186, 249-253. 2.Otto-Ślusarczyk D, Graboń W, Mielczarek-Puta M. Aminotransferaza asparaginianowa--kluczowy enzym w metabolizmie ogólnoustrojowym człowieka [Aspartate aminotransferase--key enzyme in the human systemic metabolism]. Postepy Hig Med Dosw (Online). 2016 Mar 16;70:219-30. Polish. doi: 10.5604/17322693.1197373. PMID: 27117097.