Search by BoMiProt ID - Bomi4042


Primary Information

BoMiProt ID Bomi4042
Protein Name Arylacetamide deacetylase
Organism Bos taurus
Uniprot IdQ0P5B7
Milk FractionWhey
Ref Sequence Id NP_001069259.1
Aminoacid Length 399
Molecular Weight 45604
Fasta Sequence https://www.uniprot.org/uniprot/Q0P5B7.fasta
Gene Name AADAC
Gene Id 519557
Protein Existence Status reviewed

Secondary Information

Protein Function Human arylacetamide deacetylase (AADAC) plays a role in the detoxification or activation of drugs and is sometimes involved in the incidence of toxicity by catalyzing hydrolysis reactions.
Biochemical Properties Human arylacetamide deacetylase (AADAC) is a single microsomal serine esterase involved in the hydrolysis of many acetyl-containing drugs.
PTMs Disulphide bond formation and N-Linked Glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0P5B7|AAAD_BOVIN Arylacetamide deacetylase OS=Bos taurus OX=9913 GN=AADAC PE=2 SV=1 MRKKYFGFLILGVLLAGYIYVPLPDNVEEPWKIMLLNTFLKTSSYLALFGEILGLNHFMK SMALFSRIQGFPPTSDENIIVKDTTFNDIPVRIYVPQQKTKSLRRGLFYIHGGGWCFGSN DYYSYDLLSRWTAERLDAVVISTNYRLAPKYHFPVQFEDVYTALKWFLDPQNLESYGVDP GRIGISGDSAGGNLAAAVAQQLLEDPDVKIKLKVQTLIYPALQNFDFDLPSYRENAHYPV LSKSLMVRFWSEYFTTDRSLKKAMLSNQHIPLESSNLFKFVN*282WSSLLPEKFKKGHIYKTP THGSSELAKKYPGILDVKASPLLADDSKLRGLPLTYVITCQYDVLRDDGLMYVTRLQKSG VQVIHNHVEGAFHGTLAFLFTKVGYRAANQYINWLHENL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 1TMH; (5-23)
Additional Comments Prasugrel, a thienopyridine anti-platelet agent, is pharmacologically activated by hydrolysis and hydroxylation.AADAC largely contributes to prasugrel hydrolysis in both human and dog intestine.
Bibliography 1.Gabriele M, Puccini P, Lucchi M, Aprile V, Gervasi PG, Longo V. Arylacetamide Deacetylase Enzyme: Presence and Interindividual Variability in Human Lungs. Drug Metab Dispos. 2019 Sep;47(9):961-965. doi: 10.1124/dmd.119.087031. Epub 2019 Jun 24. PMID: 31235486. 2.Kurokawa T, Fukami T, Yoshida T, Nakajima M. Arylacetamide Deacetylase is Responsible for Activation of Prasugrel in Human and Dog. Drug Metab Dispos. 2016 Mar;44(3):409-16. doi: 10.1124/dmd.115.068221. Epub 2015 Dec 30. PMID: 26718653.