Search by BoMiProt ID - Bomi4016


Primary Information

BoMiProt ID Bomi4016
Protein Name ARL14 effector protein/ARF7 effector protein
Organism Bos taurus
Uniprot IdQ5EA92
Milk FractionWhey
Ref Sequence Id NP_001026931.2
Aminoacid Length 5.Xu Y, Liu Y, Guo H, Ding W. Apoptosis-Associated Speck-Like Protein Containing a CARD Deletion Ame
Molecular Weight 29209
Fasta Sequence https://www.uniprot.org/uniprot/Q5EA92.fasta
Gene Name ARL14EP/ARF7EP
Gene Id 523894
Protein Existence Status reviewed

Secondary Information

Protein Function ARL14/ARF7, is a GTPase that is selectively expressed in immune cells.RL14/ARF7-ARF7EP acts as a MYO1E receptor on MHC-II compartments for actin-based transport control.
Biochemical Properties Vvarious proteins are there controlling MHC-II transport in DCs. One of these, the GTPase ARL14/ARF7, detected on MHC-II vesicles in imDCs (Figure 7A) and selected as a starting point for building a pathway aimed at understanding the molecular basis of MHC-II transport in DCs. Guanine exchange factors (GEFs) activating ARF GTPases are specified by SEC7 domains.
PTMs Acetylation at Meth, Isopeptide bond formation, Phosphorylation at Ser,Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5EA92|AL14E_BOVIN ARL14 effector protein OS=Bos taurus OX=9913 GN=ARL14EP PE=2 SV=1 MMDPCSVGVQLRTTNECHKTYYTRHTGFKTLQELSSNDMLLLQLRTGMTLSGNNTICFHH AKVYIDRFEDLQKSCCDPFNIHKKLAKKNLHVIDLDDATFLSAKFGRQLVPGWKLCPKCT QIINGSVDVDSEDRQKRKPDSDGRTAKALRSLQFANPGKQTEFAPETGKREKRRLTKNAT AGS*183DRQVIPAKSKVYDSQGLLIFSGMDLCDCLDEDCLGCFYACPACGSTKCGAECRCDRK WLYEQIEIEGGEIIHNKHAG
Predicted Disorder Regions 130-186, 256-260
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments MHC-II transport was controlled by the GTPase ARL14/ARF7, which recruits the motor myosin 1E via an effector protein ARF7EP. This complex controls movement of MHC-II vesicles along the actin cytoskeleton in human dendritic cells (DCs). 
Bibliography 1.Vascotto, F., Lankar, D., Faure-Andre´ , G., Vargas, P., Diaz, J., Le Roux, D., Yuseff, M.I., Sibarita, J.B., Boes, M., Raposo, G., et al. (2007). The actin-based motor protein myosin II regulates MHC class II trafficking and BCR-driven antigen presentation. J. Cell Biol. 176, 1007–1019. 2.Petra Paul; Tineke van den Hoorn; Marlieke L.M. Jongsma; Mark J. Bakker; Rutger Hengeveld; Lennert Janssen; Peter Cresswell; David A. Egan; Marieke van Ham; Anja ten Brinke; Huib Ovaa; Roderick L. Beijersbergen; Coenraad Kuijl; Jacques Neefjes (2011). A Genome-wide Multidimensional RNAi Screen Reveals Pathways Controlling MHC Class II Antigen Presentation. , 145(2), 0–283. doi:10.1016/j.cell.2011.03.023