Search by BoMiProt ID - Bomi4003


Primary Information

BoMiProt ID Bomi4003
Protein Name Arginine/serine-rich coiled-coil protein 2
Organism Bos taurus
Uniprot IdA6QLS2
Milk FractionWhey
Ref Sequence Id NP_001095616.1
Aminoacid Length 435
Molecular Weight 50578
Fasta Sequence https://www.uniprot.org/uniprot/A6QLS2.fasta
Gene Name RSRC2
Gene Id 532701
Protein Existence Status reviewed

Secondary Information

Protein Function role in the constitutive and alternative splicing of mRNA and transcriptional regulation.
PTMs Acetylation on Ala, Phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QLS2|RSRC2_BOVIN Arginine/serine-rich coiled-coil protein 2 OS=Bos taurus OX=9913 GN=RSRC2 PE=2 SV=2 MAAS*4DT*6ERDGLAPEKT*16S*17PDTDKKKEQSDVS*30VS*32PRASKHHYSRSRSRSRERKRKSDNEGRKHRSRSRSKEARRHESKDKSSKKHKSEEHNDKEHSSDKGRERLNS*104SENGEDRHKRKERKSSRGRSHSRSRSRERRHRSRSRERKKSRSRSRDRKKSRSRSRERKKSRSRSRERKRRIRSRS RSRSRHRHRSRSRSRTRSRSRDRKKRIEKPRRFSRSLSRTPSPPPFRGRNTAMDAQEALA RRLERAKKLQEQREKEMVEKQKQQEIAAAAAATGGSVLNVAALLASGTQVTPQIAMAAQM AALQAKALAETGIAVPSYYNPAAVNPMKFAEQEKKRKMLWQGKKEGDKSQSAEIWEKLNF GNKDQNVKFRKLMGIKS*377EDEAGCSSVDEESYKTLKQQEEVFRNLDAQYEMARSQTHTQRG MGLGFTSSMRGMDTV
Predicted Disorder Regions 1-272, 328-363, 376-434
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Yu S, Gautam N, Quan M, Gao Y. RSRC1 suppresses gastric cancer cell proliferation and migration by regulating PTEN expression. Mol Med Rep. 2019 Aug;20(2):1747-1753. doi: 10.3892/mmr.2019.10409. Epub 2019 Jun 21. PMID: 31257492; PMCID: PMC6625388.