Search by BoMiProt ID - Bomi3986


Primary Information

BoMiProt ID Bomi3986
Protein Name Arf-GAP domain and FG repeat-containing protein 1/HIV-1 Rev-binding protein homolog/Nucleoporin-like protein RIP
Organism Bos taurus
Uniprot IdQ2TA45
Milk FractionWhey
Ref Sequence Id NP_001033260.1
Aminoacid Length 562
Molecular Weight 58134
Fasta Sequence https://www.uniprot.org/uniprot/Q2TA45.fasta
Gene Name AGFG1/HRB/RIP
Gene Id 536149
Protein Existence Status reviewed

Secondary Information

Protein Function They control the activity of the GTPbinding proteins of the ARF family by inducing the hydrolysis of GTP that is bound to Arf proteins.It also plays a role in vesicle formation.
Biochemical Properties ARF family do not have detectable intrinsic GTPase activity, the complex of the Arf GAP with Arf1 could be viewed as the functional GTPase, which essentially would consist of a heterodimer. The functional heterodimer is probably not very stable and may dissociate right after catalysis. Taken together, this indicates that specificity for Arf GTP-binding proteins is mostly dominated by Arf GAPs. Moreover, most Arf effector molecules interact with the GTP-bound form of Arf. Thus Arf GAPs may play a critical role in terminating Arf-effector protein interactions.Arf GAP was identified in yeast, Gcs1p, which is the homologue of mammalian Arf GAP1.
PTMs O-Linked Glycosylation at Ser,Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2TA45|AGFG1_BOVIN Arf-GAP domain and FG repeat-containing protein 1 OS=Bos taurus OX=9913 GN=AGFG1 PE=2 SV=1 MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLN PPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEK YEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDS*167APALHLNKGT*177PSQ S*181PVVGRSQAQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADF ANFDAFGQSSGSSNFGGFPTASHSSFQPQTTGGSAGSVNANFAHFDNFPKSSSADFGTFN TSQSHQTASAVSKVSANKAGLQTTDKYAALANLDNIFSAGQGGDQGSGFGTTGKAPVGSV VS*362VPSQS*367SASSDKYAALAELDSVFSSAATSSNAYTSTSNASSNVFGTVPVGASAQTQPAS SSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGATAATFGTASMSMPAGFGTPAPY SLPTSFSGSFQQPAFPAQAAFPQQTAFSQQPNGAGFAAFGQTKPVVTPFGQVGAAGVSSN PFMTGAPTGQFPTGSSSTNPFL
Predicted Disorder Regions 1-13, 144-329, 340-562
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Thirty-one genes encoding proteins with Arf GAP catalytic domains have been identified in humans. Ten subfamilies have been described based on domain structure and phylogenetic analysis. Six subfamilies have Arf GAP domains at the extreme N-terminus. Four subfamilies (ASAP, ACAP, AGAP and ARAP), comprising 20 proteins, have a catalytic core of PH, Arf GAP and ANK repeat domains. At least one member of eight subtypes has confirmed GAP activity.
Bibliography Anne Spang; Yoko Shiba; Paul A. Randazzo (2010). Arf GAPs: Gatekeepers of vesicle generation. , 584(12), 2646–2651. doi:10.1016/j.febslet.2010.04.005