Search by BoMiProt ID - Bomi3983


Primary Information

BoMiProt ID Bomi3983
Protein Name Arfaptin-2/ADP-ribosylation factor-interacting protein 2
Organism Bos taurus
Uniprot IdQ3ZCL5
Milk FractionWhey
Ref Sequence Id NP_001029649.1
Aminoacid Length 341
Molecular Weight 37711
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZCL5.fasta
Gene Name ARFIP2
Gene Id 514938
Protein Existence Status reviewed

Secondary Information

Protein Function involved in Golgi function along with ARF1.Arfaptin 2/POR1 has been shown to interact with the Ras-related GTPases ARF6 and Rac1, and may regulate cytoskeletal remodelling mediated by these GTPases
PTMs phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZCL5|ARFP2_BOVIN Arfaptin-2 OS=Bos taurus OX=9913 GN=ARFIP2 PE=2 SV=1 MTDGILGKAATMEIPIHGNGEAGQLPEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGD GLIPTGSGRHPS*72HSAT*76PAGPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFGRGSR TVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQE EFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRT DLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLL FHNAVSAYFAGNQKQLEQTLQQFNIKLRPPGAEKPSWLEEQ
Predicted Disorder Regions 1-89, 247-260, 327-341
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Akt phosphorylated arfaptin 2 at Ser(260).As a result of this phosphorylated protein inhibits polyQ-huntingtin-induced neurotoxicity. Lack of phosphorylation of arfaptin 2 at this site substantially modified its subcellular distribution and increased neuronal death and intranuclear inclusions caused by polyQ-huntingtin.
Bibliography 1.Peters PJ, Ning K, Palacios F, Boshans RL, Kazantsev A, Thompson LM, Woodman B, Bates GP, D'Souza-Schorey C. Arfaptin 2 regulates the aggregation of mutant huntingtin protein. Nat Cell Biol. 2002 Mar;4(3):240-5. doi: 10.1038/ncb761. PMID: 11854752. 2.Rangone H, Pardo R, Colin E, Girault JA, Saudou F, Humbert S. Phosphorylation of arfaptin 2 at Ser260 by Akt Inhibits PolyQ-huntingtin-induced toxicity by rescuing proteasome impairment. J Biol Chem. 2005 Jun 10;280(23):22021-8. doi: 10.1074/jbc.M407528200. Epub 2005 Apr 4. PMID: 15809304.