Search by BoMiProt ID - Bomi3976


Primary Information

BoMiProt ID Bomi3976
Protein Name Apoptosis regulator Bcl-2
Organism Bos taurus
Uniprot IdO02718
Milk FractionWhey
Aminoacid Length 229
Molecular Weight 25100
Fasta Sequence https://www.uniprot.org/uniprot/O02718.fasta
Gene Name BCL2
Protein Existence Status reviewed

Secondary Information

Protein Function Inhibition of apoptosis.Regulates cell death by controlling the mitochondrial membrane permeability.Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1).
Significance in milk Control proliferation of bovine mammary epithelial cells,shows antiapoptotic effect during heat stress in summer
PTMs Phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|O02718|BCL2_BOVIN Apoptosis regulator Bcl-2 OS=Bos taurus OX=9913 GN=BCL2 PE=2 SV=1 MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPS RT*62S*63PPPPPAAAAGPAPS*77PVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARERF ATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHTWIQ DNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
Predicted Disorder Regions 2 disordered segments; (1-12), (26-83)
DisProt Annotation
TM Helix Prediction 1TMH;(204-226)
Significance of PTMs Phosphorylation/dephosphorylation on Ser-63 regulates anti-apoptotic activity.Phosphorylation on Ser-63 by PKC is required for the anti-apoptosis activity and occurs during the G2/M phase of the cell cycle.three residues (Ser70, Ser87, and Thr69) within the unstructured loop of BCL-2 that are phosphorylated in response to microtubule-damaging agents, which also arrest cells at G(2)/M.Stress response kinases phosphorylate BCL-2 during cell cycle progression as a normal physiologic process to inactivate BCL-2 at G(2)/M.
Bibliography Yamamoto K, Ichijo H, Korsmeyer SJ. BCL-2 is phosphorylated and inactivated by an ASK1/Jun N-terminal protein kinase pathway normally activated at G(2)/M. Mol Cell Biol. 1999 Dec;19(12):8469-78. doi: 10.1128/MCB.19.12.8469. PMID: 10567572; PMCID: PMC84954.