Search by BoMiProt ID - Bomi3956


Primary Information

BoMiProt ID Bomi3956
Protein Name AP2-associated protein kinase 1/Adaptor-associated kinase 1
Organism Bos taurus
Uniprot IdF1MH24
Milk FractionWhey
Aminoacid Length 957
Molecular Weight 103089
Fasta Sequence https://www.uniprot.org/uniprot/F1MH24.fasta
Gene Name AAK1
Protein Existence Status reviewed

Secondary Information

Protein Function Regulates clathrin-mediated endocytosis by phosphorylating the AP2M1/mu2 subunit of the adaptor protein complex 2 (AP-2) which ensures high affinity binding of AP-2 to cargo membrane proteins during the initial stages of endocytosis. Preferentially, may phosphorylate substrates on threonine residues.
PTMs Acetylation, Methylation Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|F1MH24|AAK1_BOVIN AP2-associated protein kinase 1 OS=Bos taurus OX=9913 GN=AAK1 PE=1 SV=2 MKKFFDSRREQGGS*14GLGSGSSGGGGSTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIV FLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINSVSSGDVW EVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVE NILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLY*234S*235GKVIT TKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDK RPDIYQVSYFSFKLLKKECPIPNVQNSPIPTKLPEPVKASEAAAKKTQPKARLT*354DPIPTT ETSIAPRQRPKAGQTQPNPGILPIQPALT*389PRKRATVQPPPQAAGSSNQPGLLASVPQPKT QPPPSQPLPQSQPKQPQAPPT*441SQQPPSAPAQALPTQAQATPQHQQQLFLKQQQQQQTAPP AQQPAGTFYQQPQQQAQAPQFQAVHPAAQQPVIAQFPVVSQGSSQQQLIQNFYQQQQQQQ QLATALHQQQLLTQQAALQQKTTAAAAPQPQAQPAAAASPAPAQEPAQIQAPVRQQPKVQ TT*602PPPTIQGQKLGS*614LT*616PPS*619S*620PKAQRAGHRRILS*633DVTHSAVFGVPAS*646KST*649QLLQAAAAEASLNKSKSATTTPSGSPRASQQNVY*683NPSEGSTWNPFDDDNFSKLTAEELLNKDFAKLGEGKYPEKLGGS*727AESLIPGFQPTQGDAFAASSFSAGTAEKRKGGQTMDSSLPLLSVSDPFIPLQV PDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIEKADVAVESLIPGLEPPVPQRL PS*842QTESVTSNRTDSLTGEDSLIDCSLLSNPTTDLLEEFAPIAISAPAHKAAEDSNLISGF DVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNS*933S*934GSSESSLPNLARSLLLVDQLIDL
Predicted Disorder Regions 12-27, 412-597, 681-694, 739-754, 829-856, 883-892, 905-940
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Bovine Genome Sequencing and Analysis Consortium, Elsik, C. G., Tellam, R. L., Worley, K. C., Gibbs, R. A., Muzny, D. M., Weinstock, G. M., Adelson, D. L., Eichler, E. E., Elnitski, L., Guigó, R., Hamernik, D. L., Kappes, S. M., Lewin, H. A., Lynn, D. J., Nicholas, F. W., Reymond, A., Rijnkels, M., Skow, L. C., Zdobnov, E. M., … Zhao, F. Q. (2009). The genome sequence of taurine cattle: a window to ruminant biology and evolution. Science (New York, N.Y.), 324(5926), 522–528. https://doi.org/10.1126/science.1169588