Search by BoMiProt ID - Bomi3954


Primary Information

BoMiProt ID Bomi3954
Protein Name AP-2 complex subunit beta/AP105B/Adaptor protein complex AP-2 subunit beta/Adaptor-related protein complex 2 subunit beta/Beta-2-adaptin/Beta-adaptin/Clathrin assembly protein complex 2 beta large chain/Plasma membrane adaptor HA2/AP2 adaptin beta subunit
Organism Bos taurus
Uniprot IdP63009
Milk FractionWhey
Aminoacid Length 937
Molecular Weight 104567
Fasta Sequence https://www.uniprot.org/uniprot/P63009.fasta
Gene Name AP2B1/CLAPB1
Protein Existence Status reviewed

Secondary Information

Protein Function Component of the adaptor protein complex 2 (AP-2) coat assembly protein complex.Adaptor protein complexes function in protein transport via transport vesicles.
PTMs phosphorlation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P63009|AP2B1_BOVIN AP-2 complex subunit beta OS=Bos taurus OX=9913 GN=AP2B1 PE=1 SV=2 MTDS*4KYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGKDVSSLFPDVVNCMQT DNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRALAVRTMGCIRVDKITE YLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLDSLRDLIADSNPMVVANA VAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFILDCLSNYNPKDDREAQSI CERVTPRLSHANSAVVLSAVKVLMKFLELLPKESDYYNMLLKKLAPPLVTLLSGEPEVQY VALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELKE YATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIRDIFRK YPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAERIDNADELLESFLEGFHDESTQV QLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEV VLSEKPLISEETDLIEPTLLDELICHIGSLASVYHKPPNAFVEGSHGIHRKHLPIHHGST DAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMGAVDLLGGGL DSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKAVWLPAVKA KGLEISGTFTHRQGHIY*737MEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQ SIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLAT WKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWIL AELRIQPGNPNYTLSLKCRAPEVSQYIY*928QVYDSILKN
Predicted Disorder Regions 595-639, 672-682
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation at Tyr-737 by SRC occurs at the plasma membrane in clathrin-coated vesicles (CCVs).
Bibliography Kelly BT, Graham SC, Liska N, Dannhauser PN, Höning S, Ungewickell EJ, Owen DJ. Clathrin adaptors. AP2 controls clathrin polymerization with a membrane-activated switch. Science. 2014 Jul 25;345(6195):459-63. doi: 10.1126/science.1254836. PMID: 25061211; PMCID: PMC4333214.