Search by BoMiProt ID - Bomi3951


Primary Information

BoMiProt ID Bomi3951
Protein Name AP-1 complex subunit mu-1/AP-mu chain family member mu1A/Clathrin assembly protein complex 1 mu-1 medium chain 1/Golgi adaptor HA1/AP1 adaptin mu-1 subunit/Mu1A-adaptin
Organism Bos taurus
Uniprot IdQ2KJ81
Milk FractionExosomes
Ref Sequence Id NP_001039349.2
Aminoacid Length 423
Molecular Weight 48587
Fasta Sequence https://www.uniprot.org/uniprot/Q2KJ81.fasta
Gene Name AP1M1
Gene Id 504310
Protein Existence Status Reviewed

Secondary Information

Protein Function Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes.
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KJ81|AP1M1_BOVIN AP-1 complex subunit mu-1 OS=Bos taurus OX=9913 GN=AP1M1 PE=1 SV=3 MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWI KHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDF GYPQTTDSKILQEYITQEGHKLETGAPRPPAT*152VT*154NAVSWRSEGIKYRKNEVFLDVIESVN LLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNT*223GRGKSKSVELEDVKFHQ CVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQ FKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHF GLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQL RTQ
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices