Search by BoMiProt ID - Bomi3928


Primary Information

BoMiProt ID Bomi3928
Protein Name Ankyrin repeat domain-containing protein 54
Organism Bos taurus
Uniprot IdQ1LZC5
Milk Fractionwhey
Ref Sequence Id NP_001069605.1
Aminoacid Length 299
Molecular Weight 32466
Fasta Sequence https://www.uniprot.org/uniprot/Q1LZC5.fasta
Gene Name ANKRD54
Gene Id 538961
Protein Existence Status Reviewed

Secondary Information

Protein Function Ankyrin repeat domain-containing protein 54 plays an important role in regulating intracellular signaling events associated with erythroid terminal differentiation.
Biochemical Properties a novel nuclear-cytoplasmic (containing functional NLS and NES motifs) shuttling adaptor of the Src family tyrosine kinase Lyn and other signalling molecules (e.g., HCLS1), that regulates down-stream signalling in erythropoietin-responsive erythroid cells[
PTMs Acetylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1LZC5|ANR54_BOVIN Ankyrin repeat domain-containing protein 54 OS=Bos taurus OX=9913 GN=ANKRD54 PE=2 SV=1 MAAAAGGADDESRSGRSSSDGECAVAPEPLTGPEGLFSFADFGSALGGGAGLPGRAS*57GGA QS*62PLRYLHVLWQQDAEPRDELRCKIPAGRLRRAARPHRRLGPTGKEVHALKRLRDSANAN DVETVQQLLEEGTDPCAADDKGRTALHFASCNGNDQIVQLLLDHGADPNQRDGLGNTPLH LAACTNHAPVITTLLRGGARVDALDRAGRTPLHLAKSKLNILQEGHSQCLEAVRLEVKQI IQMLREYLERLGRHEQRERLDDLCTRLQKTSTREQVDEVTDLLASFTSLSLQMQNMEKR
Predicted Disorder Regions 1-58, 100-105
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs phosphorylation by PKCδ as a major regulator of nuclear-cytoplasmic shuttling of Ankrd54.Activation of PKC kinases promoted nuclear export and phosphorylation of Ankrd54, and increased interaction and cytoplasmic co-localization with Lyn. Co-expression of an active form of the PKCδ isoform specifically promoted both phosphorylation and cytoplasmic localization of Ankrd54. Alanine mutation of several serine residues in the amino-terminal region of Ankrd54 reduced both phorbol 12-myristate 13-acetate induced cytoplasmic localization and phosphorylation of Ankrd54.PKCδ as a major regulator of nuclear-cytoplasmic shuttling and interaction of Ankrd54 with Lyn, through its phosphorylation of at least the Ser18 residue.
Bibliography 1.Samuels AL, Louw A, Zareie R, Ingley E. Control of nuclear-cytoplasmic shuttling of Ankrd54 by PKCδ. World J Biol Chem. 2017 Aug 26;8(3):163-174. doi: 10.4331/wjbc.v8.i3.163. PMID: 28924458; PMCID: PMC5579962. 2.Samuels, A. L., Louw, A., Zareie, R., & Ingley, E. (2017). Control of nuclear-cytoplasmic shuttling of Ankrd54 by PKCδ. World journal of biological chemistry, 8(3), 163–174. https://doi.org/10.4331/wjbc.v8.i3.163