Search by BoMiProt ID - Bomi3881


Primary Information

BoMiProt ID Bomi3881
Protein Name Angiomotin-like protein 2
Organism Bos taurus
Uniprot IdF1MRK3
Milk Fractionwhey
Ref Sequence Id XP_010799902.1
Aminoacid Length 766
Molecular Weight 84727
Fasta Sequence https://www.uniprot.org/uniprot/F1MRK3.fasta
Gene Name AMOTL2
Gene Id 538514
Protein Existence Status reviewed

Secondary Information

Protein Function It regulates the translocation of phosphorylated SRC to peripheral cell-matrix adhesion sites. It is essential for proper architecture of actin filaments. It also participates in angiogenesis.
Biochemical Properties It inhibits the Wnt/beta-catenin signaling pathway, probably by recruiting CTNNB1 to recycling endosomes and hence preventing its translocation to the nucleus.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|F1MRK3|AMOL2_BOVIN Angiomotin-like protein 2 OS=Bos taurus OX=9913 GN=AMOTL2 PE=2 SV=3 MRTLEDSSGTVLHRLIQEQLRYGNLTETRTLLAIQQQALRGGAGAGGTGSPQAPMEIMAP EDSQVLQQATRQEPQGQEHQGTETHLAENGLYRLCPQPGKGEELPTY*107EEAKAHSQYYASQ QAGPWPHVGDRDPRGPPGGSRRQDEALRELRHGHVRSLSERLLQLSLERNGARTPSHMSA SHSFPQLARNQQGPPARGAPTAEGPEPRGPPPQYPHVMLAHETTSAVTDPRYRARGSPHF QHAEVRILQAQVPPVFLPQQQQQYQYLQQPQERHPPPHLAALSPPGVEGPASTQASLATS GSTHLAQMETVLRENARLQRDNERLQRELESTAEKAGRIEKLESEIQRLSEAHESLTRAS SKREALEKTMRNKMDSEMRRLQDFNRDLRERLESANRRLASKTQEAQAGSQDMVAKLLAQ SYEQQQEQEKLEREMALLRGAIEDQRRRAELLEQALSNAQGRAARAEEELRKKQAYVEKV ERLQQALGQLQAACEKREQLELRLRTRLEQELKALRAQQRQAGTPGGGGGSGGTPELSAL RLSEQLREKEEQVLALEADMTKWEQKYLEERAMRQFAMDAAATAAAQRDTTLIRHSPQPS PSSSFNEGLLTGGHRHQEMESRLKVLHAQILEKDAVIKVLQQRSRKDPGKVTPGSLRPAK SVPSIFVAAAAGTQGWQGHSSSERQVDASAQLAADRAPLEEPVAVAPLAAHAKHGSRDGS TQTDGPPDSLEPDSLLGCSSGQRTAS*746LDS*749IATSRVQDFSDMVEILI
Predicted Disorder Regions 46-84, 103-109, 183-210, 253-283, 711-732, 746-758
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation at Tyr-107 is necessary for efficient binding to SRC and synergistically functioning with SRC to activate the downstream MAPK pathway
Bibliography Han, H., Yang, B., & Wang, W. (2017). Angiomotin-like 2 interacts with and negatively regulates AKT. Oncogene, 36(32), 4662–4669. https://doi.org/10.1038/onc.2017.101