Search by BoMiProt ID - Bomi3880


Primary Information

BoMiProt ID Bomi3880
Protein Name Angiomotin-like protein 1
Organism Bos taurus
Uniprot IdE1BEQ5
Milk FractionWhey
Aminoacid Length 960
Molecular Weight 106671
Fasta Sequence https://www.uniprot.org/uniprot/E1BEQ5.fasta
Gene Name AMOTL1
Protein Existence Status reviewed

Secondary Information

Protein Function essential for endothelial cell migration during mouse embryogenesis.component of tight junctions.TJs form an apical junctional structure and act to control paracellular permeability and maintain cell polarity.Also regulates endothelial cell migration and capillary formation.
PTMs Phosphorylation on Ser and Thr,Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|E1BEQ5|AMOL1_BOVIN Angiomotin-like protein 1 OS=Bos taurus OX=9913 GN=AMOTL1 PE=3 SV=1 MLMLHVKRNTCEHTFKCPPPACYSPSSPVQILEDPSYFFPDFQLYPGRHEASLTVEANSS IREKVVEDPLCNFHPPNFPRIPEVEMRGSEDAAAGTVLQRLIQEQLRYGTPTENMNLLAI QHQATGSAGPAHPTNFSSTENLAQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSAQPQ QNNEELPTYEEAKAQSQFFRGQQPPPPPPQQQPGAVGHSYYMAGGASQKARTEGRPTVSR ANS*243GQAHKDEALKELKQGHVRSLSERIMQLS*271LERNGAKQHLPGPGNGKAFKAGGGPS*297PAQ PAAKMLDPRGPPPEYPFKTKQMVSPVSKTQEHGLFYSDQHPGLLHEMVKPYPAPQPARTE VAVLRYQPPPEYGVTSRPCQLPFPSTAQQHSPVSSQNSSVSGPLHSVPLPLAPPMALGAA PPPPAASPSQQLGPDAFAIVERAQQMVEILTEENRVLHQELQGYYDNADKLHKFEKELQR ISEAYESLVKSTTKRESLDKAMRNKLEGEIRRLHDFNRDLRDRLETANRQLSSREYDGHE DRAAEGLYASQNKEFLKEKEKLEMELAAVRTASEDHRRHIEILDQALSNAQARVIKLEEE LREKQAYVEKVEKLQQALTQLQSACEKREQMERRLRTWLERELDALRTQQKHGNSQPASL PEYNAPALMELVREKEERILALEADMTKWEQKYVEESAIRHFAMSAAATAAAERDTTIVN HS*722RNGSYGESSLEAHIWQEEEEVVQATRRCQDMEYTIKNLHAKIIEKDAMIKVLQQRSRK DAGKTDSSSLRPARS*795VPSIAAATGTHS*807RQTSLTSSQLAEERKEEKTWKGS*830IATGLLLGKE HNDHASTPLLPTPSAATLSPPTPGTSASSAHAKTGSKDSSTQTDKSAELFWPGVASLPTR SRLS*904GT*906PSNS*910PVLKHPAAKGTAEKLENSPGHGKSPDHKGRVSNLLHKPEFPDGEMMEVLI
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction no TM helices
Significance of PTMs AMOTL1 ubiquitination induced by NEDD4L may also be involved in Lats1(large tumor suppressor kinase 1) activation.
Additional Comments Inhibits the Wnt/beta-catenin signaling pathway, probably by recruiting CTNNB1 to recycling endosomes and hence preventing its translocation to the nucleus.
Bibliography 1.Zheng Y, Vertuani S, Nyström S, Audebert S, Meijer I, Tegnebratt T, Borg JP, Uhlén P, Majumdar A, Holmgren L. Angiomotin-like protein 1 controls endothelial polarity and junction stability during sprouting angiogenesis. Circ Res. 2009 Jul 31;105(3):260-70. doi: 10.1161/CIRCRESAHA.109.195156. Epub 2009 Jul 9. PMID: 19590046. 2.Wei Y, Yee PP, Liu Z, Zhang L, Guo H, Zheng H, Anderson B, Gulley M, Li W. NEDD4L-mediated Merlin ubiquitination facilitates Hippo pathway activation. EMBO Rep. 2020 Dec 3;21(12):e50642. doi: 10.15252/embr.202050642. Epub 2020 Oct 14. PMID: 33058421; PMCID: PMC7726808.