Search by BoMiProt ID - Bomi3876


Primary Information

BoMiProt ID Bomi3876
Protein Name Angio-associated migratory cell protein
Organism Bos taurus
Uniprot IdQ3SZK1
Milk FractionExosomes
Ref Sequence Id NP_001070463.1
Aminoacid Length 434
Molecular Weight 46829
Fasta Sequence https://www.uniprot.org/uniprot/Q3SZK1.fasta
Gene Name AAMP
Gene Id 767919
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells retina
Protein Function Angio-associated migratory cell protein (AAMP) is considered a pro-tumor protein, which contributes to angiogenesis, proliferation, adhesion, and other biological activities.
Biochemical Properties It is predicted to have two immunoglobulin-like 319 domains, a heparin binding consensus sequence, and a repeat WD40 motif.
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SZK1|AAMP_BOVIN Angio-associated migratory cell protein OS=Bos taurus OX=9913 GN=AAMP PE=2 SV=1 MESESESGAAADTPPLETLS*20FHGDEEIIEVVELDPGPPDPDDLVQEMEDVDFEEEEEEEG NEEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWR LSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWM EWHPRAPVLLAGTADGNTWMWKVPTGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIR IWDLKQGNSIHVLKGTEGHQGPLTCVATNQDGSLILTGSVDCQAKLVSATTGKVVGVFRP ETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLSTQTLRHQCQHQSG IVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSG DHKAKVFCVQRPDR
Predicted Disorder Regions 1-80, 305-318
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments AAMP overexpression suppressed the interaction between CDC42 and ARHGAP1.
Bibliography 1.Yao S, Shi F, Mu N, Li X, Ma G, Wang Y, Sun X, Liu X, Su L. Angio-associated migratory cell protein (AAMP) interacts with cell division cycle 42 (CDC42) and enhances migration and invasion in human non-small cell lung cancer cells. Cancer Lett. 2021 Apr 1;502:1-8. doi: 10.1016/j.canlet.2020.11.050. Epub 2020 Dec 3. PMID: 33279622. 2.L. Yu, C. Gaitatzes, E. Neer, T.F. Smith, Thirty-plus functional families from a single motif, Protein Sci. 9 (2000) 2470-2476. 3.C. Zhang, F. Zhang, The Multifunctions of WD40 Proteins in Genome Integrity and Cell Cycle Progression, J. Genomics 3 (2015) 40-50.