Search by BoMiProt ID - Bomi3857


Primary Information

BoMiProt ID Bomi3857
Protein Name Aminoacyl tRNA synthase complex-interacting multifunctional protein 2/Multisynthase complex auxiliary component p38/Protein JTV-1
Organism Bos taurus
Uniprot IdQ0II26
Milk FractionWhey
Ref Sequence Id NP_001069281.1
Aminoacid Length 320
Molecular Weight 35178
Fasta Sequence https://www.uniprot.org/uniprot/Q0II26.fasta
Gene Name AIMP2/JTV1
Gene Id 520979
Protein Existence Status reviewed

Secondary Information

Protein Function is required for assembly and stability of the aminoacyl-tRNA synthase complex.role in the aggregation of α-synuclein in mice.Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.But a splicing variant of AIMP2 lacking exon 2, referred to as AIMP2-DX2, is oncogenic and compromises the pro-apoptotic activity of AIMP2 by competing with it for p53 and TRAF2.
Biochemical Properties is a homodimer with interaction speculated to be mediated by the C Terminal GST domain.While its splice variant DX2 seems to be in a dynamic equilibrium between the monomer and dimer in solution state.
PTMs Phosphorylation,Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0II26|AIMP2_BOVIN Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 OS=Bos taurus OX=9913 GN=AIMP2 PE=2 SV=1 MPMYQVKPYHEGSGSLRVELPTCMYRLPNVHGRTGPAPSADHVQEASDPSLQALESHQD DILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPAALSTSTVDLNAMLGQDHGALK DIVINANPASPPLSLLVLHRLLCDHYKVLSSVHTHSAVRSVPANLLQCFGEQTRQQPRHE YQLGFTLIWKDVPKTQMKFSVQTMCPIEGEGNIARFLFSLFGQKQDAVNLTLIDSWVDIA IFQLKEGSSKEKAAVFRSMNSALGKTPWLVGDELTVADVVLWSVLRQTGGCGGMAPANVQ KWMQACENLAPFHTALKLLQ
Predicted Disorder Regions 4-12, 28-56
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Upon DNA damage, AIMP2 was phosphorylated on Serine residue by JNk, dissociated from the multi-tRNA synthetase complex, and translocated into the nuclei of cells. AIMP2 directly interacts with p53, thereby preventing MDM2-mediated ubiquitination and degradation of p53.Both unphosphorylated and phosphorylated AIMP2 bound to p53 have similar affinities.
Additional Comments AIMP2 knockdown ameliorated the α-synuclein aggregation and dopaminergic cell death in response to PFF or 6-hydroxydopamine treatment.
Bibliography 1.Jha R, Cho HY, Mushtaq AU, Lee K, Kim DG, Kim S, Jeon YH. Purification and biophysical characterization of the AIMP2-DX2 protein. Protein Expr Purif. 2017 Apr;132:131-137. doi: 10.1016/j.pep.2017.02.002. Epub 2017 Feb 7. PMID: 28185908. 2.Han JM, Park BJ, Park SG, Oh YS, Choi SJ, Lee SW, Hwang SK, Chang SH, Cho MH, Kim S. AIMP2/p38, the scaffold for the multi-tRNA synthetase complex, responds to genotoxic stresses via p53. Proc Natl Acad Sci U S A. 2008 Aug 12;105(32):11206-11. doi: 10.1073/pnas.0800297105. Epub 2008 Aug 11. PMID: 18695251; PMCID: PMC2516205.