Search by BoMiProt ID - Bomi3847


Primary Information

BoMiProt ID Bomi3847
Protein Name Alpha-synuclein
Organism Bos taurus
Uniprot IdQ3T0G8
Milk FractionWhey
Ref Sequence Id NP_001029213.1
Aminoacid Length 140
Molecular Weight 14508
Fasta Sequence https://www.uniprot.org/uniprot/Q3T0G8.fasta
Gene Name SNCA
Gene Id 282857
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells Abundant in axon terminals of presynaptic neurons.
Protein Function highly enriched in presynaptic nerve terminals.synaptic vesicle trafficking and subsequent neurotransmitter release.
Biochemical Properties The central half of the alpha-synuclein polypeptide, containing five tandem repeats as well as a part of the carboxyl-terminal acidic region, forms the core structure of alpha-synuclein filaments, which is coated by the amino- and carboxyl-terminal portions at the periphery.
PTMs Phosphorylated.Ubiquitinated.Acetylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T0G8|SYUA_BOVIN Alpha-synuclein OS=Bos taurus OX=9913 GN=SNCA PE=2 SV=1 MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGRTKEGVLYVGSKTKEGVVHGVTTVAEKTK EQVTNVGEAVVTGVTAVAQKTVEGAGIAAATGFGKKDHMGKGEEGASQEGILEDMPVDP DNEAEMPEEGYQDYEPEA
Predicted Disorder Regions 1 disordered segment; (1-140)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylated on Tyr-125 upon osmotic stress.Acetylation at Met-1 for proper folding and native oligomeric structure.
Additional Comments Accumulation of misfolded oligomers and larger aggregates of α-synuclein defines multiple neurodegenerative diseases called synucleinopathies
Bibliography Burré J, Sharma M, Südhof TC. Cell Biology and Pathophysiology of α-Synuclein. Cold Spring Harb Perspect Med. 2018 Mar 1;8(3):a024091. doi: 10.1101/cshperspect.a024091. PMID: 28108534; PMCID: PMC5519445.