Primary Information |
---|
BoMiProt ID | Bomi3847 |
---|
Protein Name | Alpha-synuclein |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q3T0G8 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001029213.1 |
---|
Aminoacid Length | 140 |
---|
Molecular Weight | 14508 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q3T0G8.fasta |
---|
Gene Name | SNCA |
---|
Gene Id | 282857 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | Abundant in axon terminals of presynaptic neurons. |
---|
Protein Function | highly enriched in presynaptic nerve terminals.synaptic vesicle trafficking and subsequent neurotransmitter release. |
---|
Biochemical Properties | The central half of the alpha-synuclein polypeptide, containing five tandem repeats as well as a part of the carboxyl-terminal acidic region, forms the core structure of alpha-synuclein filaments, which is coated by the amino- and carboxyl-terminal portions at the periphery. |
---|
PTMs | Phosphorylated.Ubiquitinated.Acetylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3T0G8|SYUA_BOVIN Alpha-synuclein OS=Bos taurus OX=9913 GN=SNCA PE=2 SV=1
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGRTKEGVLYVGSKTKEGVVHGVTTVAEKTK
EQVTNVGEAVVTGVTAVAQKTVEGAGIAAATGFGKKDHMGKGEEGASQEGILEDMPVDP
DNEAEMPEEGYQDYEPEA
|
---|
Predicted Disorder Regions | 1 disordered segment; (1-140) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | Phosphorylated on Tyr-125 upon osmotic stress.Acetylation at Met-1 for proper folding and native oligomeric structure. |
---|
Additional Comments | Accumulation of misfolded oligomers and larger aggregates of α-synuclein defines multiple neurodegenerative diseases called synucleinopathies |
---|
Bibliography | Burré J, Sharma M, Südhof TC. Cell Biology and Pathophysiology of α-Synuclein. Cold Spring Harb Perspect Med. 2018 Mar 1;8(3):a024091. doi: 10.1101/cshperspect.a024091. PMID: 28108534; PMCID: PMC5519445. |