Search by BoMiProt ID - Bomi3844


Primary Information

BoMiProt ID Bomi3844
Protein Name Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
Organism Bos taurus
Uniprot IdQ08E15
Milk FractionWhey
Ref Sequence Id NP_001001151.2
Aminoacid Length 332
Molecular Weight 38034
Fasta Sequence https://www.uniprot.org/uniprot/Q08E15.fasta
Gene Name ST6GALNAC6
Gene Id 407222
Protein Existence Status reviewed

Secondary Information

Protein Function Catalyzes the transfer of N-acetylneuraminyl groups onto glycan chains in glycoproteins. 
Biochemical Properties the substrate speci¢city of cST6GalNAc I is almost the same as that of mouse, and also cST6GalNAc II exhibits similar substrate speci¢city to the mouse enzyme.
PTMs Glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08E15|SIA7F_BOVIN Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 OS=Bos taurus OX=9913 GN=ST6GALNAC6 PE=2 SV=1 MACPRPLSQCDHTPLPGPPAGHWPLPLSRRRREMKSNKEQRSAVFVILFALITILILYSS SSANEVFHYGSLRGRTRRPVNLRKWSITDGYIPILGN*97KTLPSRCGQCVIVTSSSHLLGTK LGPEIERAECTIRMNDAPTTGYSADVGNKTTFRVVAHSSVFHVLRRPQEFVNRTPETVFI FWGPPNKMQKPQGSLVRVIQRAGLVFPNMEAYAISLSRMRQFDDLFRSETGKDREKSHSW LSTGWFTMVIAVELCDHVHVYGMVPPDYCSLRPHLQRMPYHYYEPKGPDECVTYIQNENS RKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
Predicted Disorder Regions (1-35)
DisProt Annotation
TM Helix Prediction 1TMH; (42-60)
Additional Comments Genetic interactions of C1GALT1 and ST6GALNAC2 variants influence IgA1 O-glycosylation, disease predisposition, and disease severity, and may contribute to the polygenic nature of IgAN. 
Bibliography 1.Samyn-Petit B, Krzewinski-Recchi MA, Steelant WF, Delannoy P, Harduin-Lepers A. Molecular cloning and functional expression of human ST6GalNAc II. Molecular expression in various human cultured cells. Biochim Biophys Acta. 2000 Apr 6;1474(2):201-11. doi: 10.1016/s0304-4165(00)00020-9. PMID: 10742600.