Search by BoMiProt ID - Bomi3828


Primary Information

BoMiProt ID Bomi3828
Protein Name Alpha-actinin-1/Alpha-actinin cytoskeletal isoform/F-actin cross-linking protein/Non-muscle alpha-actinin-1
Organism Bos taurus
Uniprot IdQ3B7N2
Milk FractionWhey
Ref Sequence Id NP_001030428.1
Aminoacid Length 892
Molecular Weight 102980
Fasta Sequence https://www.uniprot.org/uniprot/Q3B7N2.fasta
Gene Name ACTN1
Gene Id 524770
Protein Existence Status reviewed

Secondary Information

Protein Function F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein
PTMs Phosphorylation on Tyr and Ser and Acetylation on Lys and Met
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3B7N2|ACTN1_BOVIN Alpha-actinin-1 OS=Bos taurus OX=9913 GN=ACTN1 PE=2 SV=1 MDHYDS*6QQTNDY*12MQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMT YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR APENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRM VSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPS*471fVNARCQKIC DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT IEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI NGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEM HGTLEDQLNHLRQYEKS*677IVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQL LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGY DIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDK NYITVDELRRELPPDQAEYCIARMAPYTGPDAVPGALDYMSFSTALYGES*890DL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments increased α-actinin-1 expression destabilizes E-cadherin-based adhesions, which is likely to promote the migratory potential of breast cancer cells. Furthermore, our results identify α-actinin-1 as a candidate prognostic biomarker in basal-like breast cancer.
Bibliography Kovac B, Mäkelä TP, Vallenius T. Increased α-actinin-1 destabilizes E-cadherin-based adhesions and associates with poor prognosis in basal-like breast cancer. PLoS One. 2018 May 9;13(5):e0196986. doi: 10.1371/journal.pone.0196986. PMID: 29742177; PMCID: PMC5942811.