Search by BoMiProt ID - Bomi3825


Primary Information

BoMiProt ID Bomi3825
Protein Name Alpha-1-syntrophin
Organism Bos taurus
Uniprot IdQ0P5E6
Milk Fractionwhey
Ref Sequence Id NP_001069366.1
Aminoacid Length 505
Molecular Weight 53873
Fasta Sequence https://www.uniprot.org/uniprot/Q0P5E6.fasta
Gene Name SNTA1
Gene Id 527488
Protein Existence Status Reviewed

Secondary Information

Protein Function It serves an important role in synapse formation and in the organization of UTRN and acetylcholine receptors at the neuromuscular synapse
Biochemical Properties Interacts with the dystrophin protein DMD in a calmodulin dependent manner and with related protein UTRN; SGCA of the dystrophin glycoprotein complex; F-actin; calmodulin and with the other members of the syntrophin family SNTB1 and SNTB2.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0P5E6|SNTA1_BOVIN Alpha-1-syntrophin OS=Bos taurus OX=9913 GN=SNTA1 PE=2 SV=1 MASGRRAPRTGLLELRAGAGSGAGGERWQRAVLSLEEDALTVSPADGEPGPEPGAQREPE PAQLNGAAEPGAASPPLPEALLLQPRRVTVRKADAGGLGIS*101IKGGRENKMPILISKIFKG LAADQTEALFVGDAILSVNGEDLSSATHDEAVQVLKKTGKEVVLEVKYMKEVSPYFKNSA SGTS*184VGWDS*189PPAS*193PLQRQPS*200SPGPPPRDLRDAKHMSLKMAYVSRRCTPTDPETRYLEICSADGRDTLFLRAKDEASAKSWAAAIQAQVNTLTPRVKDELQALLSATSTAGSQDIKRIGWL TEQLPSGGTAPTLALLTEKELLLYSCLPQTREALSRPARTAPLITTRLVHSGPSKGSVPY DAELSFALRTGTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRA CSLSVHIDNGFTLWAAEPGAARAVLLRQPFEKLQMSSDDGASLLFLDFGGAEGEIQLDLH SCPKTMVFIIHSFLSAKVTRLGLLA
Predicted Disorder Regions 1-9, 32-76, 181-222
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation may inhibit the interaction with DMD.Phosphorylated by CaM-kinase II
Bibliography Bhat, H. F., Baba, R. A., Adams, M. E., & Khanday, F. A. (2014). Role of SNTA1 in Rac1 activation, modulation of ROS generation, and migratory potential of human breast cancer cells. British journal of cancer, 110(3), 706–714. https://doi.org/10.1038/bjc.2013.723