Search by BoMiProt ID - Bomi3820


Primary Information

BoMiProt ID Bomi3820
Protein Name Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A/N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase Iva/UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase Iva
Organism Bos taurus
Uniprot IdO77836
Milk FractionWhey
Ref Sequence Id NP_803486.1
Aminoacid Length 535
Molecular Weight 61618
Fasta Sequence https://www.uniprot.org/uniprot/O77836.fasta
Gene Name MGAT4A
Gene Id 282276
Protein Existence Status reviewed

Secondary Information

Protein Function Glycosyltransferase that participates in the transfer of N-acetylglucosamine to the core mannose residues of N-linked glycans.Regulating the formation of tri- and multiantennary branching structures on membrane proteins that require glycosylation as signal for its exportation in the Golgi apparatus.Involved in glucose transport by mediating SLC2A2/GLUT2 glycosylation, thereby controlling cell-surface expression of SLC2A2 in pancreatic beta cells.
PTMs Glycosylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|O77836|MGT4A_BOVIN Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A OS=Bos taurus OX=9913 GN=MGAT4A PE=1 SV=1 MRLRNGTVATVLAFITSFLTLSWYTTWQNGKEKVIAYQREFLALKERLRIAEHRISQRSS ELSAIVQQFKRVEAETN*77RSKDPVNKFSDDTLKILKELTSKKSLQVPSIYYHLPHLLQNEG SLQPAVQIGNGRTGVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGET DTDYVNGVVANLEKEFSKEISSGLVEIISPPESYYPDLTNLKETFGDSKERVRWRTKQNL DYCFLMMYAQEKGTYYIQLEDDIIVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMF QAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQ HVGLHSSLTGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWA ITPVAGDYILFKFDKPVNVESYLFHSGNQDHPGDILLN*458TTVEVLPLKSEGLDIS*474KETKDK RLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKVTN
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 1TMH; (7-25)
Additional Comments MGAT4A was identified as a genetic marker for pancreatic cancer in addition to its known role in choriocarcinoma development
Bibliography 1.López-Orduña E, Cruz M, García-Mena J. The transcription of MGAT4A glycosyl transferase is increased in white cells of peripheral blood of type 2 diabetes patients. BMC Genet. 2007 Oct 22;8:73. doi: 10.1186/1471-2156-8-73. PMID: 17953760; PMCID: PMC2148049.