Search by BoMiProt ID - Bomi3797


Primary Information

BoMiProt ID Bomi3797
Protein Name Aldehyde oxidase 1/Azaheterocycle hydroxylase 1
Organism Bos taurus
Uniprot IdP48034
Milk FractionExosomes
Ref Sequence Id NP_788841.1
Aminoacid Length 1339
Molecular Weight 147611
Fasta Sequence https://www.uniprot.org/uniprot/P48034.fasta
Gene Name AOX1
Gene Id 338074
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells  liver, lungs,spleen,kindey, eye, testis, duodenum, esophagus and thymus.
Protein Function Aldehyde oxidase 1 (AOX1) is involved in the detoxification of a variety of aldehydes and nitrogenous heterocyclic compounds. 
Biochemical Properties molybdenum enzyme,a homodimeric molybdenum cofactor (Moco)‐containing protein with a molecular mass of 300 kDa (2 × 150 kDa)
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P48034|AOXA_BOVIN Aldehyde oxidase 1 OS=Bos taurus OX=9913 GN=AOX1 PE=1 SV=2 MEGGSELLFYVNGRKVTEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN PITKKIRHYPANACLTPICSLYGAAVTTVEGIGSTKTRIHPVQERIAKCHGTQCGFCTPG MVMSLYTLLRNHPEPTLTQLNDALGGNLCRCTGYRPIINACKTFCKTSGCCQSKENGVCC LDQGMNGLPEFEEGNETSLKLFSEEEFLPLDPTQELIFPPELMTMAEKKTQKTRIFGSDR MTWISPVTLKELLEAKVKYPQAPVVMGNTSVGPDMKFKGIFHPVIISPDRIEELSVVNYT DNGLTLGAAVSLAEVKDILANVTRKLPEEKTQMYHALLKHLETLAGPQIRNMASLGGHIV SRHPDSDLNPLLAVGNCTLNLLSKEGRRQIPLNEQFLRKCPSADLKPEEILISVNIPYSR KWEFVSAFRQAQRQQNALAIVNSGMRVCFGKGDGIIRELSIAYGGVGPTTILANNSCQKL IGRPWNEEMLDAACRLILDEVSLPGSAPGGRVEFKRTLIVSFLFKFYLEVSQILKGMDLV HYPSLASKYESALEDLHSRHYWSTLKYQNADLKQLSQDPIGHPIMHLSGIKHATGEAIYC DDMPVVDRELFLTFVTSSRAHAKIVSIDVSAALSLPGVVDILTGEHLPGINTTFGFLTDA DQLLSTDEVSCVGQLVCAVIADSEVQARRAAQQVKIVYQDLEPVILTIEEAIQNKSFFEP ERKLEYGNVDEAFKMVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDREIDVYVSAQFPK YIQDITASVLKVSANKVMCHVKRVGGAFGGKVTKTGVLAAITAFAANKHGRPVRCILERG EDILITGGRHPYLGKYKAGFMNDGRILALDMEHYNNAGAFLDESLFVIEMGLLKLENAYK FPNLRCRGWACRTNLPSNTALRGFGFPQAGLITEACITEVAAKCGLPPEKVRMINMYKEI DQTPYKQEINTKNLTQCWKECMATSSYTLRKAAVEKFNSENYWKKKGLAMVPLKYPIGLG SVAAGQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELRMPLS*1069SIHLRGTSTET IPNTNPSGGSVVADLNGLAVKDACQTLLKRLKPIISKNPKGTWKDWAQAAFNESISLSAT GYFRGYESNINWETGEGHPFEYFVYGAACSEVEIDCLTGAHKNIRTDIVMDVGYSINPAL DVGQIEGAFIQGMGLYTIEELNYSPQGVLYTRGPNQYKIPAICDIPMELHISFLPPSENS NTLYSSKGLGESGIFLGCSVFFAIHDAIRAARQERGLPGPLRLNSPLTPEKIRMACEDKF TKMIPRDEPGSYVPWSVPI
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments  high expression of AOX1 promoted proliferation and invasion and inhibited apoptosis via reactive oxygen species (ROS) production.
Bibliography 1.Zhang W, Chai W, Zhu Z, Li X. Aldehyde oxidase 1 promoted the occurrence and development of colorectal cancer by up-regulation of expression of CD133. Int Immunopharmacol. 2020 Aug;85:106618. doi: 10.1016/j.intimp.2020.106618. Epub 2020 May 26. PMID: 32470878.