Search by BoMiProt ID - Bomi3784


Primary Information

BoMiProt ID Bomi3784
Protein Name Alanine aminotransferase 1(ALT1)/Glutamate pyruvate transaminase 1/GPT 1/Glutamic--alanine transaminase 1/Glutamic--pyruvic transaminase 1
Organism Bos taurus
Uniprot IdA4IFH5
Milk FractionWhey
Ref Sequence Id NP_001077209.1
Aminoacid Length 496
Molecular Weight 55275
Fasta Sequence https://www.uniprot.org/uniprot/A4IFH5.fasta
Gene Name GPT/GPT1
Gene Id 539188
Protein Existence Status reviewed

Secondary Information

Protein Function This protein plays an essential role in starch synthesis in developing seeds that are exposed to low concentrations of oxygen.
Biochemical Properties OsAlaAT1 is localized in the cytosol and has aminotransferase enzyme activity. AlaAT catalyzes the interconversion of pyruvate to alanine, and this pathway is activated under low-oxygen conditions.
PTMs Acetylation at Ala,Phosphorylation at Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A4IFH5|ALAT1_BOVIN Alanine aminotransferase 1 OS=Bos taurus OX=9913 GN=GPT PE=2 SV=1 MALRAGEHSQEAANGLKEKVLTLDS*22MNPYVRRVEYAVRGPIVQRALELEQELRQGVKKPF TEVIRANIGDAQAMGQIPITFPRQVLALCVHPDLLNSPDFPDDAKRRAERILQACGGHSL GAYSISAGVQMIREDVARYIERRDGGIPADPNNIFLSTGASDAIVTVLKLLVTGEGRTRT GVLIPIPQYPLYSAALAEFNAVQVDYYLDEERAWALDVAELRRALRQARDHCRPRALCVI NPGNPTGQVQTRECIEDVIRFAYEEKLFLLADEVYQDNVYAESSQFHSFKKVLTEMGPPY AAQQELASFHSISKGYMGECGFRGGYVEVVNMDAAVKQQMQKLRSVRLCPPTPGQVLLDV AVSPPAPSDPSFPRFQAERRAVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPRVQL PPRAVQRAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPMEKLRPL LEKLSQFHAKFTREYS
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation at Thr-9 by ALPK1 gives rise to the formation of an intermolecular binding between the FHA domain and also promotes TIFA oligomerization and TIFA-mediated NF-kappa-B activation.
Additional Comments The osalaat1 mutant has less amylose and its amylopectin is structurally altered. 
Bibliography Yang J, Kim SR, Lee SK, Choi H, Jeon JS, An G. Alanine aminotransferase 1 (OsAlaAT1) plays an essential role in the regulation of starch storage in rice endosperm. Plant Sci. 2015 Nov;240:79-89. doi: 10.1016/j.plantsci.2015.07.027. Epub 2015 Aug 3. PMID: 26475189.