Search by BoMiProt ID - Bomi3781


Primary Information

BoMiProt ID Bomi3781
Protein Name Akirin-2
Organism Bos taurus
Uniprot IdA8YXY8
Milk Fractionwhey
Ref Sequence Id NP_001103557.1
Aminoacid Length 203
Molecular Weight 22510
Fasta Sequence https://www.uniprot.org/uniprot/A8YXY8.fasta
Gene Name AKIRIN2
Gene Id 614292
Protein Existence Status Reviewed

Secondary Information

Protein Function It is required for the innate immune response. Downstream effector of the Toll-like receptor (TLR), TNF and IL-1 beta signaling pathways leading to the production of IL-6. Forms a complex with YWHAB that acts to repress transcription of DUSP1
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A8YXY8|AKIR2_BOVIN Akirin-2 OS=Bos taurus OX=9913 GN=AKIRIN2 PE=2 SV=1 MACGATLKRTLDFDPLLS*18PAS*21PKRRRCAPLSAPTSAAATPSSAAAATAASFSAAAAS*57PQK YLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLL SGPASPGTPSGTSSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYD AFVKFTHDQIMRRYGEQPASYVS
Predicted Disorder Regions 1-142, 189-203
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Karabay, A. Z., Koc, A., Ozkan, T., Hekmatshoar, Y., Altinok Gunes, B., Sunguroglu, A., Buyukbingol, Z., Atalay, A., & Aktan, F. (2018). Expression analysis of Akirin-2, NFκB-p65 and β-catenin proteins in imatinib resistance of chronic myeloid leukemia. Hematology (Amsterdam, Netherlands), 23(10), 765–770. https://doi.org/10.1080/10245332.2018.1488795