Search by BoMiProt ID - Bomi3759


Primary Information

BoMiProt ID Bomi3759
Protein Name Advanced glycosylation end product-specific receptor
Organism Bos taurus
Uniprot IdQ28173
Milk FractionWhey
Ref Sequence Id NP_776407.1
Aminoacid Length 416
Molecular Weight 44182
Fasta Sequence https://www.uniprot.org/uniprot/Q28173.fasta
Gene Name AGER
Gene Id 280986
Protein Existence Status reviewed

Secondary Information

Protein Function cell surface receptor for advanced glycation end-products (RAGE). involved in inflammatory and immune responses .
Biochemical Properties Its 5 flanking region from -505 overlaps with the PBX2 gene.The protein exhibits only one transmembrane domain (343-363 AA) and has a short highly charged cytosolic tail (364-404 AA) that is critical to intracellular signaling. The V domain and its closest C domain have a high content of arginine and lysine residues carrying a positive charge; the second C domain has mainly acidic residues and is charged negatively. These three distinct domains explain how RAGE can be a multiligand receptor, with the ability to assemble as a multimer depending on the ligand.
PTMs N-linked Glycosylation on asparagine
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q28173|RAGE_BOVIN Advanced glycosylation end product-specific receptor OS=Bos taurus OX=9913 GN=AGER PE=1 SV=1 MAAGAVVGAWMLVLSLGGTVTGDQN*25ITARIGKPLVLNCKGAPKKPPQQLEWKLNTGRTEA WKVLSPQGDPWDSVARVLPN*80GSLLLPAVGIQDEGTFRCRATSRSGKETKSNYRVRVYQIP GKPEIVDPASELMAGVPNKVGTCVSEGGYPAGTLNWLLDGKTLIPDGKGVSVKEETKRHP KTGLFTLHSELMVTPARGGALHPTFSCSFTPGLPRRRALHTAPIQLRVWSEHRGGEGPNV DAVPLKEVQLVVEPEGGAVAPGGTVTLTCEAPAQPPPQIHWIKDGRPLPLPPGPMLLLPE VGPEDQGTYSCVATHPSHGPQESRAVSVTIIETGEEGTTAGSVEGPGLETLALTLGILGG LGTVALLIGVIVWHRRRQRKGQERKVPENQEEEEEERAELNQPEEPEAAESSTGGP
Predicted Disorder Regions 3 disordered segments; (236-244), (317-347), (378-415)
DisProt Annotation
TM Helix Prediction 1TMH ; (351-373)
Bibliography Serveaux-Dancer M, Jabaudon M, Creveaux I, Belville C, Blondonnet R, Gross C, Constantin JM, Blanchon L, Sapin V. Pathological Implications of Receptor for Advanced Glycation End-Product (AGER) Gene Polymorphism. Dis Markers. 2019 Feb 4;2019:2067353. doi: 10.1155/2019/2067353. PMID: 30863465; PMCID: PMC6378764.