Search by BoMiProt ID - Bomi3745


Primary Information

BoMiProt ID Bomi3745
Protein Name Adseverin/Scinderin
Organism Bos taurus
Uniprot IdQ28046
Milk FractionWhey
Ref Sequence Id NP_776602.1
Aminoacid Length 715
Molecular Weight 80578
Fasta Sequence https://www.uniprot.org/uniprot/Q28046.fasta
Gene Name SCIN
Gene Id 281478
Protein Existence Status reviewed

Secondary Information

Protein Function Adseverin is a Ca2+-dependent actin filament-severing protein that has been reported to regulate exocytosis via rearrangements of the actin cytoskeleton in secretory cells.Adseverin has a crucial role in osteoclastogenesis by regulating NFATc1.
Biochemical Properties Adseverin contains six gelsolin-like (G) domains, three actin binding sites and two calcium binding sites with different affinities.
Significance in milk Role in bone development
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q28046|SCIN_BOVIN Scinderin OS=Bos taurus OX=9913 GN=SCIN PE=1 SV=1 MAQGLYHEEFARAGKRAGLQVWRIEKLELVPVPESAYGNFYVGDAYLVLHTTQASRGFTY RLHFWLGKECTQDESTAAAIFTVQMDDYLGGKPVQNRELQGY*102ESTDFVGYFKGGLKYKAG GVASGLNHVLTNDLTAQRLLHVKGRRVVRATEVPLSWDSFNKGDCFIIDLGTEIYQWCGS SCNKYERLKASQVAIGIRDNERKGRAQLIVVEEGSEPSELTKVLGEKPKLRDGEDDDDIK ADITNRKMAKLYMVSDASGSMKVSLVAEENPFSMAMLLSEECFILDHGAAKQIFVWKGKD ANPQERKAAMKTAEEFLQQMNYSTNTQIQVLPEGGETPIFKQFFKDWRDRDQSDGFGKVY VTEKVAHVKQIPFDASKLHSSPQMAAQHHVVDDGSGKVQIWRVENNGRVEIDRNSYGEFY GGDCYIILYTYPRGQIIYTWQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVSQGKEPA HLLSLFKDKPLIIYKNGTSKKEGQAPAPPIRLFQVRRNLASITRIMEVDVDANSLNSNDV FVLKLRQNNGYIWIGKGSTQEEEKGAEYVASVLKCKTSTIQEGKEPEEFWNSLGGKKDY*502Q TSPLLESQAEDHPPRLYGCSNKTGRFIIEEVPGEFTQDDLAEDDVMLLDAWEQIFIWIGK DANEVEKSESLKSAKIYLETDPSGRDKRTPIVIIKQGHEPPTFTGWFLGWDSSRW
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Adseverin knockdown also suppressed the RANKL-mediated induction of nuclear factor of activated T-cell c1 (NFATc1), which is a key transcription factor in osteoclastogenesis.
Bibliography 1.Song, M. K., Lee, Z. H., & Kim, H. H. (2015). Adseverin mediates RANKL-induced osteoclastogenesis by regulating NFATc1. Experimental & molecular medicine, 47(12), e199. https://doi.org/10.1038/emm.2015.94