Search by BoMiProt ID - Bomi3736


Primary Information

BoMiProt ID Bomi3736
Protein Name ADP-ribosylation factor GTPase-activating protein 3/ARF GAP 3
Organism Bos taurus
Uniprot IdQ17R07
Milk FractionWhey
Ref Sequence Id NP_001069442.1
Aminoacid Length 517
Molecular Weight 56766
Fasta Sequence https://www.uniprot.org/uniprot/Q17R07.fasta
Gene Name ARFGAP3
Gene Id 532778
Protein Existence Status Reviewed

Secondary Information

Protein Function ARFGAP3 colocalized with COPI subunits in the Golgi complex and peripheral punctate structures and associated with COPI-coated vesicles generated from Golgi membranes.It is a GTPase-activating protein (GAP) for ADP ribosylation factor 1 (ARF1)
Biochemical Properties ARFGAP3 has an N-terminal GATA1 (305371)-type zinc finger motif containing 4 cysteines that is highly conserved among ARFGAPs, as well as multiple potential phosphorylation sites.
PTMs Phosphorylation on ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q17R07|ARFG3_BOVIN ADP-ribosylation factor GTPase-activating protein 3 OS=Bos taurus OX=9913 GN=ARFGAP3 PE=2 SV=1 MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLS FIRSTELDSNWSWFQLRCMQVGGNANASSFFHQHGCDTNDTNAKYNSRAAQLYRERIKAL ASQATRKHGTDLWLDSCVVPPSSPPPKEEDFFASHASPEVSSTGWASAQPEPSLTPRNVD APAASSEGVPEQGPSVEGLNVPTKAAVGEVSSIIKKKPNQAKRGLGAKKGS*231LGAQKLSNT CFNEIEKQAQAVDKMNAQEDLLSRAAPKEES*271IVSS*275LRLAYKDLEIQMKKDEKMNMSGKKK AESERLGMGFGNSRSGISHSVTSDMQTIEQETPITAKPRKKYGDDSDDSYFTSSSRFFDE PMELRSSSFSS*371WDDSSDSYWKKETIKDTDPIPKNTGYTDRPTTRRKPDSEPAENTDEAQK KFGNVKAIS*429SDMYFGRQAKADYEARARLERLS*452AS*454SS*456IS*458S*459ADLFDEQRKQTAGSYNLTSVLPTAPDMAQFKQGVRSVAGKLSVFANGVMTSIQDRYGS
Predicted Disorder Regions 134-244, 258-269, 287-302, 321-425, 457-466
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Holden, J. L., Nur-E-Kamal, M. S., Fabri, L., Nice, E., Hammacher, A., & Maruta, H. (1991). Rsr1 and Rap1 GTPases are activated by the same GTPase-activating protein and require threonine 65 for their activation. The Journal of biological chemistry, 266(26), 16992–16995.