Search by BoMiProt ID - Bomi3717


Primary Information

BoMiProt ID Bomi3717
Protein Name Adhesion G protein-coupled receptor L1/Calcium-independent alpha-latrotoxin receptor 1/CIRL-1/Latrophilin-1
Organism Bos taurus
Uniprot IdO97831
Milk Fractionwhey
Ref Sequence Id NP_001107200.1
Aminoacid Length 1472
Molecular Weight 162205
Fasta Sequence https://www.uniprot.org/uniprot/O97831.fasta
Gene Name ADGRL1/LPHN1
Gene Id 788252
Protein Existence Status reviewed

Secondary Information

Protein Function It serves as calcium-independent receptor of high affinity for alpha-latrotoxin.
Biochemical Properties Interacts with syntaxin and with proteins of the SHANK family via the PDZ domain
PTMs Glycosylation, Methylation, Phosphorylation and Disulphide bond,Proteolytic cleavage
Significance of PTMs Autoproteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit. This proteolytic processing takes place early in the biosynthetic pathway, either in the endoplasmic reticulum or in the early compartment of the Golgi apparatus.
Linking IDs Bomi3717
Bibliography Matsushita, H., Lelianova, V. G., & Ushkaryov, Y. A. (1999). The latrophilin family: multiply spliced G protein-coupled receptors with differential tissue distribution. FEBS letters, 443(3), 348–352. https://doi.org/10.1016/s0014-5793(99)00005-8
Protein Function It serves as calcium-independent receptor of high affinity for alpha-latrotoxin.
Biochemical Properties Interacts with syntaxin and with proteins of the SHANK family via the PDZ domain
PTMs Glycosylation, Methylation, Phosphorylation and Disulphide bond,Proteolytic cleavage
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|O97831|AGRL1_BOVIN Adhesion G protein-coupled receptor L1 OS=Bos taurus OX=9913 GN=ADGRL1 PE=2 SV=1 MARLAAVLWSLCVTAILVTSATQGLSRAGLPFGLMRRELACEGYPIELRCPGSDVIMVEN ANYGRTDDKICDADPFQMENVQCYLPDAFKIMSQRCNN*98RTQCVVVAGSDAFPDPCPGTYK YLEVQYDCVPYKVKQKVFVCPGTLQKVLEPTSTHESEHQSGAWCKDPLQAGDRIYVMPWI PYRTDTLTEYASWEDYVAARHTTTYRLPNRVDGTGFVVYDGAVFYNKERTRNIVKYDLRT RIKSGETVINTANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEGNNGRLVVSQLNPYTL RFEGTWETGYDKRSASNAFMVCGVLYVLRSVYVDDDSEAAGNRVDYAFNTNANREEPVSL AFPNPYQFVSSVDYNPRDNQLYVWNNYFVVRYSLEFGPPDPSAGPATSPPLSTTTTARPT PLTSTASPAATTPLRRAPLTTHPVGAINQLGPDLPPATAPAPSTRRPPAPNLHVSPELFC EPREVRRVQWPATQQGMLVERPCPKGTRGIASFQCLPALGLWNPRGPDLSN*531CTSPWVNQV AQKIKSGENAANIASELARHTRGSIYAGDVSSSVKLMEQLLDILDAQLQALRPIERESAG KNYNKMHKRERTCKDYIKAVVETVDNLLRPEALESWKDMN*640ATEQAHTATMLLDVLEEGAF LLADNVREPARFLAAKQNVVLEVTVLNTEGQVQELVFPQEYPSENSIQLSANTIKQNSRN GVVKVVFILYNNLGLFLSTEN*741ATVKLAGEAGSGGPGGASLVVNSQVIAASINKESSRVFL MDPVIFTVAHLEAKNHFNAN*800CSFWN*805YSERSMLGYWSTQGCRLVESN*826KTHTTCACSHLTNF AVLMAHREIYQGRINELLLSVITWVGIVISLVCLAICISTFCFLRGLQTDRNTIHKNLCI NLFLAELLFLVGIDKTQYEIACPIFAGLLHYFFLAAFSWLCLEGVHLYLLLVEVFESEYS RTKYYYLGGYCFPALVVGIAAAIDYRSYGTEKACWLRVDNYFIWSFIGPVSFVIVVNLVF LMVTLHKMVRSSSVLKPDSSRLDNIKSWALGAIALLFLLGLTWAFGLLFINKESVVMAYL FTTFNAFQGVFIFVFHCALQKKVHKEYSKCLRHSYCCIRSPPGGAHGSLKTSAMRSNARY YTGTQSRIRRMWNDTVRKQTESSFMAGDINSTPTLNRGTMGNHLLTNPVLQPRGGTSPYN TLIAESVGFNPSSPPVFNS*1219PGSYREPKHPLGGREACGMDTLPLNGNFNNSYSLRSGDFPP GDGAPEPPRGRNLADAAAFEKMIISELVHNNLRGGSSGAKGPPPPEPPVPPVPGGSGEEE AGGPGADRAEIELLYKALEEPLLLPRAQSVLYQSDLDESESCTAEDGATSRPLSSPPGRD SLYASGANLRDSPSYPDSSPEGPSEALPPPPPAPPGPPEIYYTSRPPALVARNPLQGYYQ VRRPSHEGYLAAPGLEGPGPDGDGQMQLVTS*1471L
Predicted Disorder Regions 406-457, 1162-1263, 1295-1421
DisProt Annotation
TM Helix Prediction 7TMHs; (7-25), (862-884), (928-950), (965-983), (1003-1025), (1048-1070), (1077-1095)
Significance of PTMs Autoproteolytically cleaved into 2 subunits, an extracellular subunit and a seven-transmembrane subunit. This proteolytic processing takes place early in the biosynthetic pathway, either in the endoplasmic reticulum or in the early compartment of the Golgi apparatus.
Linking IDs
Bibliography Matsushita, H., Lelianova, V. G., & Ushkaryov, Y. A. (1999). The latrophilin family: multiply spliced G protein-coupled receptors with differential tissue distribution. FEBS letters, 443(3), 348–352. https://doi.org/10.1016/s0014-5793(99)00005-8