Search by BoMiProt ID - Bomi3701


Primary Information

BoMiProt ID Bomi3701
Protein Name Adenylyl cyclase-associated protein 1
Organism Bos taurus
Uniprot IdQ3SYV4
Milk FractionWhey
Ref Sequence Id NP_001030182.1
Aminoacid Length 472
Molecular Weight 51273
Fasta Sequence https://www.uniprot.org/uniprot/Q3SYV4.fasta
Gene Name CAP1
Protein Existence Status reviewed

Secondary Information

Protein Function Highly conserved in evolution.Bifunctional protein involved in Ras-adenylyl cyclase and F-actin dynamics regulation.
Biochemical Properties conserved RLE motif in mammalian CAP1 interacts with other coiled-coil–containing proteins.CAP1 can be separated into two subdomains: a helical N-terminal (1 to 318) and a β-sheet C-terminal (319 to 475) subdomain.
Significance in milk is a key negative regulator of milk synthesis and proliferation of bovine mammary epithelial cells
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SYV4|CAP1_BOVIN Adenylyl cyclase-associated protein 1 OS=Bos taurus OX=9913 GN=CAP1 PE=2 SV=3 MADMRNLVERLERVVGRLEAVSHASDTHCGY*31GDS*34AAKAGTTPYVQAFDSLLAGPVAEYLK ISKEIGGDVQKHAEMVHTGLKLERALLVTASQCQQPAGNKLSDLLAPISEQIQEVVTFRE KNRGSKLFNHLSAVSESIQALGWVAMAPKPGPYVKEMNDAAMFYTNRVLKEYKDVDKKHV DWVKAYLSIWTELQAYIKEFHTTGLAWSRTGPVAKELSGLPSGPSAGSGPPPPPPGPPPP PVPTSSGSDDSASRSALFAQINQGESITHALKHVSDDMKTHKNPALKAQS*290GLIRS*295GPKPF S*301ASKPDPPKPVAKKEPALLELEGKKWRVENQENVSNLMIEDTELKQVAYIFKCVNSTLQI KGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHVYLSKN SLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG
Predicted Disorder Regions 29-39, 210-253, 270-314
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs phosphorylated S308 and S310 in CAP1 promoted lung cancer cell proliferation, migration, and metastasis both in vitro and in vivo. When de-phosphorylated, these two sites in CAP1 showed the opposite effect. Phosphorylation of CAP1 can promote epithelial–mesenchymal transition (EMT).
Bibliography Zeng, J., Li, X., Liang, L. et al. Phosphorylation of CAP1 regulates lung cancer proliferation, migration, and invasion. J Cancer Res Clin Oncol 148, 137–153 (2022). https://doi.org/10.1007/s00432-021-03819-9