Search by BoMiProt ID - Bomi3690


Primary Information

BoMiProt ID Bomi3690
Protein Name Adenosylhomocysteinase 3/IP(3)Rs binding protein released with IP(3) 2/Long-IRBIT
Organism Bos taurus
Uniprot IdA6QLP2
Milk FractionWhey
Ref Sequence Id NP_001094613.1
Aminoacid Length 611
Molecular Weight 66774
Fasta Sequence https://www.uniprot.org/uniprot/A6QLP2.fasta
Gene Name AHCYL2
Gene Id 532836
Protein Existence Status reviewed

Secondary Information

Protein Function It may be involved in regulation of the sodium-bicarbonate cotransporter SLC4A4 activity and Mg2+-sensitivity.
Biochemical Properties Involved in L-homocysteine biosynthesis.Catalyses the following reaction, H2O + S-adenosyl-L-homocysteine = adenosine + L-homocysteine
PTMs Phosphorylation, Acetylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QLP2|SAHH3_BOVIN Adenosylhomocysteinase 3 OS=Bos taurus OX=9913 GN=AHCYL2 PE=1 SV=1 MSVQVVSAAAAAKVPEVELKDLSPSEAEPQLGLSTAAVSAMAPPAGGGDPEAPAPAAERP PAPGPGSGPAAALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEALVS*107PDGTVTEAPRTVK KQIQFADQKQEFNKRPTKIGRRSLSRSIS*149QSS*152TDS*155YSS*158AASYTDSSDDETSPRDKQQKNSKGNSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTA VLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVN DSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYV TEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGH SNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIILLAEGRLLNLSCSTVPTFVLSITA TTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNK NGPFKPNYYRY
Predicted Disorder Regions (1-94), (109-183)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylated during neuronal differentiation at the LISN domain.
Bibliography Yamaguchi, S., & Ishikawa, T. (2014). AHCYL2 (long-IRBIT) as a potential regulator of the electrogenic Na(+)-HCO3(-) cotransporter NBCe1-B. FEBS letters, 588(5), 672–677. https://doi.org/10.1016/j.febslet.2013.12.036