Search by BoMiProt ID - Bomi3648


Primary Information

BoMiProt ID Bomi3648
Protein Name Acyl-CoA-binding domain-containing protein 6
Organism Bos taurus
Uniprot IdA2VDR2
Milk FractionWhey
Ref Sequence Id NP_001077252.1
Aminoacid Length 282
Molecular Weight 31275
Fasta Sequence https://www.uniprot.org/uniprot/A2VDR2.fasta
Gene Name ACBD6
Gene Id 618245
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells
Protein Function function in hematopoiesis and development of vascular endothelium.ACBD6 binds acyl-CoAs of a chain length of 6 to 20 carbons.ACBD6 negatively affected the formation of phosphatidylcholine (PC) and phosphatidylethanolamine in the red blood cell membrane.
Biochemical Properties ACBD6 bound all 3 acyl-CoA substrates , binding to unsaturated C18:1-CoA and C20:4-CoA with relatively high affinity and to the shorter and saturated C16:0-CoA with lower affinity. With C18:1-CoA as ligand, titration curves revealed 2 different binding constants, suggesting that ligand binding to the low-affinity site(s) occurred only after saturation of the high-affinity site(s). The stoichiometry of acyl-CoA binding suggested that ACBD6 functioned as a monomer and bound a total of 4 ligand molecules. Deletion of the C-terminal ankyrin motifs did not affect ligand binding by ACBD6.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A2VDR2|ACBD6_BOVIN Acyl-CoA-binding domain-containing protein 6 OS=Bos taurus OX=9913 GN=ACBD6 PE=2 SV=1 MASSFLPSGATTGDSGGELSSGDDSGDVESLQSPKIEASRS*41LPELFEKAAEHLQGLVQVA SREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKALGDSS*106PSQAMQEYIAVVKK LDPSWNPQSPEKKGKEANTGFGGPVVSSLYHEEIIREEDKDIFDYCRENNIDHITKVIKT KNMDVNMKDEEGRTLLHWACDRGHKELVTVLLQYRADINCQDNEGQTALHYAAACEFLDI VELLLQSGADPTLRDQDGCLPEEVTGCKAVTLMLQQHTTGKA
Predicted Disorder Regions 2 disordered segments; (1-42), (130-141)
DisProt Annotation
TM Helix Prediction no TM helices
Bibliography Soupene E, Serikov V, Kuypers FA. Characterization of an acyl-coenzyme A binding protein predominantly expressed in human primitive progenitor cells. J Lipid Res. 2008 May;49(5):1103-12. doi: 10.1194/jlr.M800007-JLR200. Epub 2008 Feb 11. PMID: 18268358; PMCID: PMC2311440.