Search by BoMiProt ID - Bomi3646


Primary Information

BoMiProt ID Bomi3646
Protein Name Acyl-CoA-binding domain-containing protein 5/Endozepine-related protein/Membrane-associated diazepam-binding inhibitor
Organism Bos taurus
Uniprot IdP07106
Milk FractionWhey
Ref Sequence Id NP_851381.1
Aminoacid Length 533
Molecular Weight 59653
Fasta Sequence https://www.uniprot.org/uniprot/P07106.fasta
Gene Name ACBD5/DBI
Gene Id 353160
Protein Existence Status reviewed

Secondary Information

Protein Function ACBD5 binds to VAPB and regulates Peroxisome–ER association.
Biochemical Properties Contain acyl-coenzyme A–binding domain (AcB) which is for acyl-coenzyme A (acyl-CoA) binding.VAPB and ACBD5 interact directly via the ACBD5 FFAT-like motif.
PTMs Acetylation and Phosphorylation
Linking IDs Bomi3646
Bibliography Costello JL, Castro IG, Hacker C, Schrader TA, Metz J, Zeuschner D, Azadi AS, Godinho LF, Costina V, Findeisen P, Manner A, Islinger M, Schrader M. ACBD5 and VAPB mediate membrane associations between peroxisomes and the ER. J Cell Biol. 2017 Feb;216(2):331-342. doi: 10.1083/jcb.201607055. Epub 2017 Jan 20. PMID: 28108524; PMCID: PMC5294785.
Protein Function ACBD5 binds to VAPB and regulates Peroxisome–ER association.
Biochemical Properties Contain acyl-coenzyme A–binding domain (AcB) which is for acyl-coenzyme A (acyl-CoA) binding.VAPB and ACBD5 interact directly via the ACBD5 FFAT-like motif.
PTMs Acetylation and Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P07106|ACBD5_BOVIN Acyl-CoA-binding domain-containing protein 5 OS=Bos taurus OX=9913 GN=ACBD5 PE=2 SV=2 MFQFHAGSWESWCCCCCLIPGDRPWDRGRRWRLEMADTRSVHETRFEAAVKVIQSLPKNG SFQPTNEMMLKFYSFYKQATEGPCKLSKPGFWDPVGRYKWDAWSSLGDMTKEEAMIAYVE EMKKILETMPMTEKVEELLHVIGPFYEIVEDKKSGRSSDLTSVRLEKISKCLEDLGNVLA STPNAKTVNGKAES*194S*195DS*197GAES*201EEEAAQEDPKRPEPRDSDKKMMKKSADHKNLEIIVTNGYDKDS*244FVQGVQNSIHTSPSLNGRCTEEVKSVDENLEQTGKTVVFVHQDVNSDHVEDISGIQ HLTSDSDSEVYCDS*314MEQFGQEESLDGFISNNGPFSYYLGGNPSQPLESSGFPEAVQGLPG NGSPEDMQGAVVEGKGEVKRGGEDGGSNSGAPHREKRAGESEEFSNIRRGRGHRMQHLSE GSKGRQVGS*429GGDGERWGSDRGSRGSLNEQIALVLMRLQEDMQNVLQRLHKLEMLAASQAK SSALQTSNQPTSPRPSWWPFEMSPGALTFAIIWPFIAQWLVHLYYQRRRRKLN
Predicted Disorder Regions 1-9, 157-164, 186-360, 370-440, 476-495
DisProt Annotation
TM Helix Prediction 1TMH; (503-525)
Linking IDs
Bibliography Costello JL, Castro IG, Hacker C, Schrader TA, Metz J, Zeuschner D, Azadi AS, Godinho LF, Costina V, Findeisen P, Manner A, Islinger M, Schrader M. ACBD5 and VAPB mediate membrane associations between peroxisomes and the ER. J Cell Biol. 2017 Feb;216(2):331-342. doi: 10.1083/jcb.201607055. Epub 2017 Jan 20. PMID: 28108524; PMCID: PMC5294785.