Search by BoMiProt ID - Bomi3628


Primary Information

BoMiProt ID Bomi3628
Protein Name Actin-related protein 8
Organism Bos taurus
Uniprot IdQ1LZF2
Milk FractionWhey
Ref Sequence Id NP_001069829.1
Aminoacid Length 624
Molecular Weight 70485
Fasta Sequence https://www.uniprot.org/uniprot/Q1LZF2.fasta
Gene Name ACTR8/ARP8
Gene Id 615133
Protein Existence Status reviewed

Secondary Information

Protein Function  Arp4, assisted by Arp8, influences actin polymerization in vitro and is able to depolymerize actin filaments.The another contribution of Arp8 is enhancing the nucleosome-binding ability of INO80 is significant.
Biochemical Properties Actin, Arp4 and Arp8 together with the helicase-SANTassociated (HSA) domain of the Ino80 ATPase form a stable sub-module of INO80, while Arp5 together with INO80 subunits Ies2 and Ies6 associate with the AAA+ ATPase subunits Rvb1/Tip49 and Rvb2/Tip48.
PTMs N-Linked Acetylation at Meth,Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1LZF2|ARP8_BOVIN Actin-related protein 8 OS=Bos taurus OX=9913 GN=ACTR8 PE=2 SV=1 MTQAEKGEAENGKEKGGEKEKEQRGVKRPIVPALVPESLQEQIQSNFIVVIHPGSTTLRI GRATDTLPASVPHVIARRHKQQGQPLYKDSWLLREGLNKPESNEQRQNGLKMVDQAIWSK KMSNGTRRIPVS*132PEQARSYNKQMRPAILDHCSGNKWTNTSHHPEFLVGEEALYVNPLDCY NIHWPIRRGQLNIHPGPGGSLTAVLADIEVIWSHAIQKYLEIPLKDLKYYRCILLIPDIY NKQHVKELVNMILMKMGFSGIVVHQESVCATFGSGLSSTCIVDVGDQKTSVCCVEDGVSH RNTRLCLAYGGSDVSRCFYWLMQRAGFPYRECQLTNKMDCLLLQHLKETFCHLDQDISGL QDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHRS*412QGDPEDPH DEQYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLGPSQGDC LMAGNDSEEALTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDETKKKMYSSILVVGG GLMFHKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGAVLACLDTTQE LWIYQREWQRFGVRMLRERAAFVW
Predicted Disorder Regions 1-40, 83-132, 416-476
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Deleting Arp8 in Saccharomyces cerevisiae results in an INO80 complex that also lacks Arp4 and actin, in addition to the losses of DNA binding and ATPase activities
Bibliography 1.. Szerlong,H., Hinata,K., Viswanathan,R., Erdjument-Bromage,H., Tempst,P. and Cairns,B.R. (2008) The HSA domain binds nuclear actin-related proteins to regulate chromatin-remodeling ATPases. Nat. Struct. Mol.Biol., 15, 469–476. 2.Chen,L., Cai,Y., Jin,J., Florens,L., Swanson,S.K., Washburn,M.P., Conaway,J.W. and Conaway,R.C. (2011) Subunit organization of the human INO80 chromatin remodeling complex. J. Biol. Chem., 286, 11283–11289. 3.. Shen,X., Ranallo,R., Choi,E. and Wu,C. (2003) Involvement of actin-related proteins in ATP-dependent chromatin remodeling. Mol. Cell, 12, 147–155. 4.Fenn S, Breitsprecher D, Gerhold CB, Witte G, Faix J, Hopfner KP. Structural biochemistry of nuclear actin-related proteins 4 and 8 reveals their interaction with actin. EMBO J. 2011 Jun 1;30(11):2153-66. doi: 10.1038/emboj.2011.118. Epub 2011 Apr 15. PMID: 21499228; PMCID: PMC3117639.