Search by BoMiProt ID - Bomi3609


Primary Information

BoMiProt ID Bomi3609
Protein Name Acetylcholine receptor subunit epsilon
Organism Bos taurus
Uniprot IdP02715
Milk FractionWhey
Ref Sequence Id NP_776697.1
Aminoacid Length 491
Molecular Weight 54565
Fasta Sequence https://www.uniprot.org/uniprot/P02715.fasta
Gene Name CHRNE
Gene Id 281688
Protein Existence Status reviewed

Secondary Information

Protein Function Subunit of Ach Receptor.AChR is a pentamer consisting of α, β, γ, δ, and ε protein subunits.Imp role in neuromuscular transmission.
PTMs Disulfide bond, Glycosylation,Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P02715|ACHE_BOVIN Acetylcholine receptor subunit epsilon OS=Bos taurus OX=9913 GN=CHRNE PE=2 SV=1 MAGALLCALLLLQLLGRGEGKNEELRLYHYLFDTYDPGRRPVQEPEDTVTISLKVTLTNL ISLNEKEETLTTSVWIGIDWQDYRLN*86YSKGDFGGVETLRVPSELVWLPEIVLENNIDGQF GVAYEANVLVSEGGYLSWLPPAIYRSTCAVEVTYFPFDWQN*161CSLVFRSQTYNAEEVEFVF AVDDEGKTISKIDIDTEAYTENGEWAIDFCPGVIRRHDGDSAGGPGETDVIYSLIIRRKP LFYVINIIVPCVLISGLVLLAYFLPAQAGGQKCTVSINVLLAQTVFLFLIAQKTPETSLS VPLLGRYLIFVMVVATLIVMNCVIVLNVSLRTPTTHAMSPRLRYVLLELLPQLLGSGAPP EIPRAASPPRRASSLGLLLRAEELILKKPRSELVFEQQRHRHGTWTATLCQNLGAAAPEI RCCVDAVNFVASSTRDQEATGEEVSDWVRMGKALDSICFWAALVLFLVGSSLIFLGAYFN RVPQLPYPPCM
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction 4TMHs; (241-263),(274-292),(307-329) and (457-479)
Significance of PTMs Phosphorylation on epsilon subunit by caMP pathway which is imp for AchR stabilization.Electrical activity tends to increase pkA dependent phosphorylation of epsilon subunit.
Additional Comments ACh is a neurotransmitter involved in sympathetic, parasympathetic, and motor nerves. Additionally, the ACh synthesized/released by non-neuronal cells and tissues (collectively known as non-neuronal ACh) has been reported to be responsible for local intercellular signaling
Bibliography 1.Makino Y, Hiradate Y, Umezu K, Hara K, Tanemura K. Expression and Possible Role of Nicotinic Acetylcholine Receptor ε Subunit (AChRe) in Mouse Sperm. Biology (Basel). 2021 Jan 11;10(1):46. doi: 10.3390/biology10010046. PMID: 33440720; PMCID: PMC7826850. 2.Lanuza MA, Gizaw R, Viloria A, González CM, Besalduch N, Dunlap V, Tomàs J, Nelson PG. Phosphorylation of the nicotinic acetylcholine receptor in myotube-cholinergic neuron cocultures. J Neurosci Res. 2006 Jun;83(8):1407-14. doi: 10.1002/jnr.20848. PMID: 16555299.