Search by BoMiProt ID - Bomi3572


Primary Information

BoMiProt ID Bomi3572
Protein Name 72 kDa type IV collagenase/72 kDa gelatinase/Matrix metalloproteinase-2
Organism Bos taurus
Uniprot IdQ9GLE5
Milk FractionWhey
Ref Sequence Id NP_777170.1
Aminoacid Length 661
Molecular Weight 73777
Fasta Sequence https://www.uniprot.org/uniprot/Q9GLE5.fasta
Protein Existence Status reviewed

Secondary Information

Protein Function remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture.
Biochemical Properties Cleaves the collagen-like sequence Pro-Gln-Gly-|-Ile-Ala-Gly-Gln.
PTMs Phosphorylation and Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q9GLE5|MMP2_BOVIN 72 kDa type IV collagenase OS=Bos taurus OX=9913 GN=MMP2 PE=2 SV=1 MTEARVSRGALAALLRALCALGCLLGRAAAAPSPIIKFPGDVAPKTDKELAVQYLNTFYG CPKESCNLFVLKDTLKKMQKFFGLPQTGELDQSTIETMRKPRCGNPDVANYNFFPRKPKW DKNQITYRIIGYTPDLDPQTVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHG DGYPFDGKDGLLAHAFAPGPGVGGDSHFDDDELRTLGEGQVVRVKYGNADGEYCKFPFRF NGKEYTSCTDTGRSDGFLWCSTTYNFDKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQG TSYDSCTTEGRTDGYRWCGTTEDYDRDKEYGFCPETAMSTVGGNSEGAPCVLPFTFLGNK HESCTSAGRSDGKLWCATTSNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGA LMAPIYTYTKNFRLSHDDIQGIQELYGASPDIDTGTGPTPTLGPVTPELCKQDIVFDGIS QIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEDPQEEKAVFFAGNE YWVYSASTLERGYPKPLTSLGLPPGVQKVDAAFN*574WSKNKKTYIFAGDKFWRYNEVKKKMD PGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLEN*643QSLKSVKFGSIKSDWLG C
Predicted Disorder Regions 1 disordered segment; (452-466)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation on multiple sites modulates enzymatic activity.