Search by BoMiProt ID - Bomi3571


Primary Information

BoMiProt ID Bomi3571
Protein Name 6-phosphogluconolactonase
Organism Bos taurus
Uniprot IdQ2TBQ8
Milk FractionExosomes
Ref Sequence Id NP_001033669.1
Aminoacid Length 258
Molecular Weight 27547
Fasta Sequence https://www.uniprot.org/uniprot/Q2TBQ8.fasta
Gene Name PGLS
Gene Id 616120
Protein Existence Status Reviewed

Secondary Information

Protein Function 6-phosphogluconolactonase (PGLS), a cytosolic enzyme in the oxidative phase of the pentose phosphate pathway (PPP), expressing cells are associated with undifferentiated HCC subtypes.
PTMs Phosphorylation at Serine,N-acetylation at Alanine
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2TBQ8|6PGL_BOVIN 6-phosphogluconolactonase OS=Bos taurus OX=9913 GN=PGLS PE=2 SV=1 MAAPAPRLISVFSSPQELGASLAQLVVQQAACCLADAGARFTLGLSGGS*49LVSMLARELPA AAAPAGPASLARWTLGFCDERLVPFEHAESTYGLYRTHLLSKLPIFDSQVITINPALPVE EAAEDYAKKLRQAFQGDSIPVFDLLILGVGPDGHTCSLFPDHPLLQEREKIVAPISDSPK PPPQRVTLTLPVLNAARTVIYVATGEGKAAILKRILEDKEENPLPAALVQPSAGKLCWFL DEAAARLLTVPFEKHSTL
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Li C, Chen J, Li Y, Wu B, Ye Z, Tian X, Wei Y, Hao Z, Pan Y, Zhou H, Yang K, Fu Z, Xu J, Lu Y. 6-Phosphogluconolactonase Promotes Hepatocellular Carcinogenesis by Activating Pentose Phosphate Pathway. Front Cell Dev Biol. 2021 Oct 26;9:753196. doi: 10.3389/fcell.2021.753196. PMID: 34765603; PMCID: PMC8576403. 2.