Search by BoMiProt ID - Bomi3559


Primary Information

BoMiProt ID Bomi3559
Protein Name 60S ribosomal protein L32
Organism Bos taurus
Uniprot IdQ3SZQ6
Milk FractionExosomes
Ref Sequence Id NP_001029955.1
Aminoacid Length 135
Molecular Weight 15874
Fasta Sequence https://www.uniprot.org/uniprot/Q3SZQ6.fasta
Gene Name RPL32
Gene Id 615556
Protein Existence Status Reviewed

Secondary Information

Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SZQ6|RL32_BOVIN 60S ribosomal protein L32 OS=Bos taurus OX=9913 GN=RPL32 PE=2 SV=3 MAALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKGQILMPNIGY GS*62NKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAI RITNPNARLRSEENE
Predicted Disorder Regions 1-72, 124-135
DisProt Annotation
TM Helix Prediction No TM helices